GENSCAN 1.0	Date run: 15-Jan-104	Time: 16:25:32

Sequence AATF_1 : 110312 bp : 40.66% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +    953   1459  507  0  0   40  100   340 0.694  22.42
ggcgggaggcgtgtgcccggcctcagactactataaattgcgaaatgacaaacctgcttt
gggtcccagtctctgcgtgcccgagtgcgcacccgcgattcgagcagcttaagccctact
ccctcctccttcccaaatcagccaccgtgggccacggctacgctatgctttattcctaag
CGAATCTCGCACAAATCTCGAGGCATATTTTGTACAAGGGGACACTGGCCGCGCGCATCG
CAATCGCATCTCAGCGACAGAAGCGGTCACGTGCCTTGGCGCGCTTCCGCACCGCCCCTT
CCCGCGCACTCGCACGCGCACGCGCACACGCGCCCATACGGCTCCAATCCCTTCAACCTT
CTGCGCGCTTCCGCCTTCATGCTAGCAACGCCCGCAGTGACGCGCAGGCCCCGCCCCCTC
CCGCGCGCCTCCCGGAAGTGGCCGGTCCAGAGCTGTGGGGTGGCCTCCGCGCGGTCTCTG
GCGGAGTCGGGGAATCGGATCAAGGCGAGAGGATCCGGCAGGGAAGGAGCTTCGGGGCCG
GGGGTTGGGCCGCACATTTACGTGCGCGAAGCGGAGTGGACCGGGAGCTGGTGACGATGG
CGGGGCCGCAGCCCCTGGCGCTGCAACTGGAACAGTTGTTGAACCCGCGACCAAGCGAGG
CGGACCCTGAAGCGGACCCCGAGGAAG
gtgaggccggactggggcaggccacgtgcggagcggtgggccaggccctgtggggcaagg
gggcggcgtgggaggggcgtgcgcgaggccgccgggcctgcgctccttcgcttggcgcag
aggaacgtcgcctcccgcgagggtggtcccggcctcgggaggagggcttcggcttctttt

 1.02 Intr +   2457   2648  192  1  0   82  105   115 0.998  11.14
tgtttagaaacagcagtaagacagtgttctactttgggagagagtgaatttcctattcct
ggaagttggtggggatttcgtaaaggacgttcaactatgagataaatgggtcgaccaggg
ttcccgttaaagtttctgctaacctggagattctgtttacttttccctctcccccgacag
CCACTGCTGCCAGGGTGATTGACAGGTTTGATGAAGGGGAAGATGGGGAAGGTGATTTCC
TAGTAGTGGGTAGCATTAGAAAACTGGCATCAGCCTCCCTCTTGGACACGGACAAAAGGT
ATTGCGGCAAAACCACCTCTAGAAAAGCATGGAATGAAGACCATTGGGAGCAGACTCTGC
CAGGATCGTCTG
gtgagtagacatttttgaatggaactcttctcttccctaattttttcagggttaaaatcc
tccggtcatcccccatgatctttgcaagagtagtctgcggatcttttttttgagacagag
tttggctcttgttgcccaggctggagtgtgatggcgccatctcggctcaccgcaacctcc

 1.03 Intr +   5129   5539  411  0  0  126   58   605 0.999  54.53
tctttgcttctcccttagcattttggagattgtagatgtgtaataaatatattgttgaat
tgagtgcagtaagagattttccccctgatgccacagtgcttaagttgaaatgaagtctat
ggcttggtattttctccaggtaatacccatttttctctttcttccctctcttctttgtag
ATGAGGAAATATCTGATGAGGAAGGGTCTGGAGATGAAGATTCAGAGGGACTGGGTCTGG
AGGAATATGATGAGGACGACCTGGGTGCTGCTGAGGAACAGGAGTGTGGTGATCACAGGG
AGAGCAAGAAGAGCAGAAGCCACTCTGCAAAAACACCGGGCTTCAGTGTCCAGAGTATCA
GTGACTTTGAGAAATTTACCAAGGGAATGGATGACCTTGGGAGCAGTGAGGAGGAGGAAG
ACGAAGAGAGTGGCATGGAAGAAGGGGATGACGCGGAAGACTCCCAAGGCGAGAGTGAGG
AAGACAGGGCTGGAGATAGAAACAGTGAGGATGATGGTGTGGTGATGACCTTCTCTAGTG
TCAAAGTTTCTGAGGAAGTGGAGAAAGGAAGAGCCGTGAAGAACCAGATAG
gtttgtacatggttttgctgattgcctgtttttcaaagtatctgcatttggtctactttt
catttgtttgtttttggctattctctatctcctgtgtcctttcaattagtttgtgacatg
ccccacttacccagaagcctaaagccctattcctgtatgcttagccagccatttctgcac

 1.04 Intr +   6013   6150  138  2  0   78   55   136 0.947   8.81
cttgcttcatggatactgaatttattttctctaatagagaatatttgtttccatggcatt
aaactgctaaagctgtggtgcttagagactggtgtggtttcctgttcttccccacccctg
ccacctcacccccagaatattttattattgaggaatgggattctcttttcttcttttcag
CACTGTGGGACCAGCTCTTGGAAGGAAGGATCAAACTACAAAAAGCTCTGTTGACCACCA
ACCAGCTTCCTCAACCAGATGTTTTCCCATTGTTCAAGGACAAAGGTGGCCCAGAATTTT
CCAGTGCCCTGAAAAATA
gtaagaatacttatgtcctgttggaatacttagaaccactttgtcaaatgaagacagctt
tgattgaagtggactgggagcttgagccatgtttattgtgctttcttctcatctgccctt
gctctcccctccccatcccccttggctttccaagttgcttttttttttttttttttttga

 1.05 Intr +  16437  16542  106  1  1   89   92    52 0.947   4.05
ttttaaaaattaattttaaaaaagaaacaaaaaaagagaatggggaaaatgaaatagtaa
agtataggcaactctttgaagggttgttgctttaaaggggagcagagaaatggggcattg
gatggtgaaggatgtggtcaaaagaggggtgttttgcttttttttttttttttttttaag
GTGAAGTATCAGCGTGTTTGCATGTTGATAGGAGTGACCCAGCAGAGAGGGGGAAATTGA
TGATGCAGGAGAGGGGGACATCTGTTGTCACAGTGTCCTATAGTGG
gtgagtggggatggagtggagatgggccagtgcacaggagtgccttagatagcaatgtgg
accatctcatggtggcgggtgcctgtaatcctagctactcaggaggctgaggtaggaaaa
tcacctgaacccagaaggtggaggttgcggtgggccaagattgcgccaccgcactccagc

 1.06 Intr +  17109  17235  127  0  1   73   89    87 0.971   7.06
tccattacctgcttaaaatcatgctattttcagttcgcttcctatttatttattttttcc
cttttgcccccctcccccccactgtagctcagttttatcatctcaatcctttttttccta
aactttacatcatgccatctcttgtgttaaattttccattttgagctggttgttctctag
GAGTAGTGCACAGCTGTGCTCTTGGGCCTTTCATTGCTCTTCTGGGGAGAGCTACCGCTT
TCGGGTTTTCAGGCTCTCTTTTGTTATCTCAGTTTACTGTCAGTTTGCTGCCAAACATGC
ATCCAGA
gtaagttatctgagttcttgtaggtttgaaaatactgtgccctcattcctcattgatgta
ttcttgtttgattgggtagacctttctagattgaaaattactttccctcagaattagaaa
gtattgcctgttactggtttcctcttgctgctgtaacaaattaccgcaagcttggtgact

 1.07 Intr +  22075  22102   28  0  1  103   40    39 0.080  -2.63
actggtttgttgagatataattgacataataaattgcccatatgtccagtgtgtaatttg
acatttatatacacccgggaaaccatcaccagtcaagataatgaacatattcctcatccc
cagaagtttcctcagcctctttataatctttccctcctggccttccctatttgtccctag
GCAACCACTAAATCTGCTGTCACTATGG
gttagtttgcattttctagaaatctatataagtggaattatacagtttgtatccttttta
gtctggcttttgctcagcataattattttgagcatcctccatattttttcttgtgtcagt
agttcattgccttttgttgctgagtagtatcccattgtatggatataccacaatttgttt

 1.08 Intr +  38859  38973  115  1  1  122  116    30 0.996   7.79
aggcaacgttgttatttccatttgggaatatttcagagagtatttagttcctgtgtgtat
cctgtgcctccccttcactccccacagccagaactgctcaggagtcatgagttataggca
tcacctactttggagaattgtagataattaattgtcctttctctgtcctttatttcccag
GTCACAAGGCACTTAAAGCATTGTTGAGGTCATTGGTAGGTCTTCAGGAAGAGTTGCTTT
TCCAGTACCCAGACACTAGATATCTAGTAGATGGGACAAAGCCCAATGCGGGAAG
gtaagagaacagaatcatggagttgcttattttcttttcatttggatagtttcccatcat
ttatgaaagaaaagctaagttctcttcaggcagatattaatgttagtaaaatagagtctc
atatttacctgatggtcaggatggcacataagttggtgattagattttagatttttatat

 1.09 Intr +  40761  40968  208  0  1   70   12   284 0.999  17.16
gattgatctcatgaatattcttctcaaagagcaaaagccatccttatatctttggtgtta
ttttgaatggagacagaacaggtaaggcctaaatattctcagtcctttatgtgagcctag
tttttaaaatctaagtaatgtttgtttacactggacataatattcttactgcttttctag
TGAGGAGATTTCTAGTGAAGATGATGAGCTGGTAGAAGAGAAGAAGCAGCAACGAAGAAG
GGTCCCTGCAAAGAGGAAGCTGGAGATGGAGGACTATCCCAGCTTCATGGCAAAGCGCTT
TGCCGACTTTACAGTCTACAGGAACCGCACACTTCAGAAATGGCACGATAAGACCAAACT
GGCTTCTGGAAAACTGGGGAAGGCAAGT
gtgtgtatgcgcgcatgtatgtgtaagataggttgtggcaacttgaagaagttttaagaa
attggaactacagctcatttatatggatgttgtcacgatgtaatggtaatcattcatttc
tatagcaaaatctactgaacttctggcactggggtttatacgattcagacttgggatttt

 1.10 Intr +  41489  41653  165  1  0   97  111   155 0.999  17.94
actaactttttttttttaagaacaattatagccactcacaaactcagtcctttacagaaa
gtccctcctgaaaagatgattttctatctctctgctgacacagaaagatagagaaaccaa
tgtagcttgccttcagcactgattttctgcattatctgacactgcttaatgttgttgcag
GGTTTTGGTGCCTTTGAACGCTCAATCTTGACTCAGATCGACCATATTCTGATGGACAAA
GAGAGATTACTTCGAAGGACACAGACCAAGCGCTCTGTCTATCGAGTTCTTGGCAAACCT
GAGCCAGCAGCTCAGCCTGTCCCAGAGAGTTTGCCAGGGGAACCG
gtaagaactctgtaatgcagagtgattatggggaatagtttctatgaggcttattagctg
aaaaacttgtagctattacctgtttatataagaggttagtgagagaaaggaaagcaacac
tactttactggattactgagagaaacttgagtgtatgtgagaggagagagtttttaaaaa

 1.11 Intr +  43016  43099   84  1  0   62   94   133 0.896  10.40
caactgcctgttaatgtttttgcctgttttcatattggactgttttgttttttaatttta
agaactttttatatcttaaggaaaacagtgctttgactgttctacatattatttatagta
gctacattagttagatagccttgttgggattcactcttttcttactcattgttaacatag
GAGATCCTTCCTCAAGCCCCTGCTAATGCTCATCTGAAGGACTTGGATGAAGAAATCTTT
GATGATGATGACTTTTACCACCAG
gtgagacttttacactctcttgttacaaatcatgttttagcattttaaagcagcttatag
aattctctgaacaaagaagttgcttattttggaaggatagagtcagacagtgagttagaa
ctcccgcgttcaaaattgacttacagtgtcattgtggatttgttgcttttcttctatttt

 1.12 Intr +  71247  71314   68  2  2  123   86    91 0.645   9.18
aagatatataactatgaaagcgttaacgggaattcagtaatgctcttgccactgggttgt
cccttattgattgtagttttagagctgtcactatgccattcagaattccttctctgccct
tttaaagtcagttgtactggaagatgataaataaattcgttgctttcctttttcccctag
CTCCTTCGAGAACTCATAGAACGGAAGACCAGCTCCTTGGATCCCAACGATCAGGTGGCC
ATGGGAAG
gtaatttagatacagctttctgttcatgcaagcagcctatgtaatagtttctccccttga
gtccctttaattctacctgcaaagcaatgattggtcctataattattgaagttaagcaag
taagagctagaaagaaaatgtgactaattgtttaccctacattgcctaaagtgcaatttg

 1.13 Intr +  73176  73256   81  0  0   73  109    72 0.528   5.63
tttttaccattgcacaaatcctgttcaattgattagtcagtttggccccaaactagcttg
aggaacttgatgtaggttgatgatttctttctgcagggttgttagaataattccaatttg
tcaatatgtataactatttctgttagtgatgatgcataacattgcttgtgaattttccag
GCAGTGGCTTGCAATCCAGAAGTTACGAAGCAAAATCCACAAAAAAGTAGATAGGAAAGC
CAGCAAAGGCAGGAAACTTCG
gtgagttacttttcggaaaaaatgtcaacatatattgtatatgtatctcgtctcttacat
tctggctgttatgtcatttttctttttcttctgatgattctgtttttaaggatcagaaaa
ataaacaatatttgaaggtttattgcaactcagtttttcttattctaaaatggaaatata

 1.14 Intr +  83854  83925   72  1  0   92  109    45 0.278   4.60
ggatgactgtagttggtcatcccaatgacagtggtaagtgcctatgaatttttccctatc
ccactttgtacccagatgttccagtgatcagttctggagtttgttaactcactgaatgtg
tttcctctcctaggttaatagttactaatgttgctgcctgttgcttcctgctttatttag
GTTTCATGTCCTTAGCAAGCTACTGAGTTTCATGGCACCTATTGACCATACTACAATGAA
TGATGATGCCAG
gtgagtaatagattaattatgtgtctcaaatggcttcatgacagcctgatattgacctgc
tctacagccttcgccctctccatttcttcttatcagttaaccatttgtcattggcatcgc
agtaagggtcacatctcttcaccctcataattactataaaaccaaaccaaaaacttgcat

 1.15 Term +  85361  85451   91  2  1   53   42    63 0.151  -5.59
gtcataacataggcacaggtggtttttgccagttttatccctcaaactacatataaactt
tttattttagagtattttgtttgctaccaaatgccatcagattttcccctccttgtctga
aagtatgagatctgcaaattttgacaaatactattattattttttatttggtttattcag
TACTTTGAGCACAAAACAGCCTATGGATGGTTCTGAGTACATTTGTGTCTGGCTTTGTGA
CCACATCTGCTATCCTGTGCTTTGCAAGTGA
atgtctagatatggccatggttttttgttcatttctggatccagtctgtttaaaaattgc
agagtaaagtgagtgcatcttagattccctgtcaggatgctgtgaaaaaattatatcaag
aagaaagcaaaactagattttgaaaattaaaccaaaccctttaaggttacgttattatcc

 2.08 PlyA -  88167  88162    6                               1.05
 2.07 Term -  95619  95432  188  1  2   60   54   123 0.923   2.77
 2.06 Intr -  97557  97530   28  0  1   85  113    -2 0.931  -1.23
 2.05 Intr -  97820  97661  160  1  1   85   76   180 0.983  15.57
 2.04 Intr - 100117  99956  162  0  0   -3   66   138 0.061   0.67
 2.03 Intr - 102969 102843  127  1  1   74   61    84 0.100   3.12
 2.02 Intr - 103551 103306  246  1  0   32   80   174 0.440   7.51
 2.01 Intr - 109077 108918  160  0  1   54   64    86 0.048   1.44

Predicted peptide sequence(s):


>AATF_1|GENSCAN_predicted_peptide_1|797_aa
XNLAQISRHILYKGTLAARIAIASQRQKRSRALARFRTAPSRALARARAHAPIRLQSLQP
SARFRLHASNARSDAQAPPPPARLPEVAGPELWGGLRAVSGGVGESDQGERIRQGRSFGA
GGWAAHLRARSGVDRELVTMAGPQPLALQLEQLLNPRPSEADPEADPEEATAARVIDRFD
EGEDGEGDFLVVGSIRKLASASLLDTDKRYCGKTTSRKAWNEDHWEQTLPGSSDEEISDE
EGSGDEDSEGLGLEEYDEDDLGAAEEQECGDHRESKKSRSHSAKTPGFSVQSISDFEKFT
KGMDDLGSSEEEEDEESGMEEGDDAEDSQGESEEDRAGDRNSEDDGVVMTFSSVKVSEEV
EKGRAVKNQIALWDQLLEGRIKLQKALLTTNQLPQPDVFPLFKDKGGPEFSSALKNSEVS
ACLHVDRSDPAERGKLMMQERGTSVVTVSYSGSSAQLCSWAFHCSSGESYRFRVFRLSFV
ISVYCQFAAKHASRATTKSAVTMGHKALKALLRSLVGLQEELLFQYPDTRYLVDGTKPNA
GSEEISSEDDELVEEKKQQRRRVPAKRKLEMEDYPSFMAKRFADFTVYRNRTLQKWHDKT
KLASGKLGKASGFGAFERSILTQIDHILMDKERLLRRTQTKRSVYRVLGKPEPAAQPVPE
SLPGEPEILPQAPANAHLKDLDEEIFDDDDFYHQLLRELIERKTSSLDPNDQVAMGRQWL
AIQKLRSKIHKKVDRKASKGRKLRFHVLSKLLSFMAPIDHTTMNDDASTLSTKQPMDGSE
YICVWLCDHICYPVLCK

>AATF_1|GENSCAN_predicted_peptide_2|356_aa
AGLGGTAPLRVLGTGSERSIFPGASLLAQPHKVTGFLHLDQQPHQPRRPLGVGENHTPPT
LALEPPGLQDIPELYLPTKTGGQQREHSHSTAPRKSLCSLPKRIMVSEQVLCASLPKELA
ETMLLLSRRKVTHRPESREKKKAHGRQVGQRVPIIAALTASRVWIRSETLQVESAQIWFQ
NNKTAAARICHKVAVHDSFPSGPSHQSAEPINYPVCLLSSPSSPVLEGDSRRGGQSIEEQ
LLVFAAFHIPYKRQKAQPPLPSEKQKGERNRTVSPGCRQPRVLLQKKGLQSYLPRNNSET
GVGDAAGYEQNEQTCRIGSVSQGLQVSALDSTWGEIGDKERKVARQQVIDGLDWQA