GENSCAN 1.0	Date run: 15-Jan-104	Time: 11:19:33

Sequence XPO6_1 : 116385 bp : 44.05% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.04 Intr -   1267    961  307  1  1   47   48   128 0.007   0.72
 1.03 Intr -  10814  10619  196  1  1   36   77    94 0.016   2.52
 1.02 Intr -  19269  19189   81  2  0   79   67    48 0.310   0.55
 1.01 Init -  20219  20083  137  2  2   82   93   108 0.961   8.49
 1.00 Prom -  21239  21200   40                              -5.16

 2.01 Init +  37089  37241  153  2  0   59  110    42 0.413   3.68
attgccatattgccccaaacctttatttaaagagggattcttgtttattgaagtgataat
agctacctgtgggatgaaaagcagttatttttgtgtataggttgttaacttaaaagatgt
atatttgtttttcagaatctgatcaataaaatgtggcttggggtcccatctcaggataag
ATGGAAATCCGTAGCTGTCTGCCCAAACTCCTTTTGGCTCACCATAAAACCTTACCTTAC
TTTATCCGGAACAAGCTCTGCAAAGTTATTGTTGATATTGGACGTCAGGATTGGCCCATG
TTCTACCACGACTTTTTTACTAACATTTTACAG
gtaaggatatgcctaaggaaactttatcttgtgaatagtttgtttgttgaagtgattatt
tccttgtcctgaagaggacttttaagattagcagtttggaactgcagtagtgaggttatt
gtaggactgattatcgcattcactttatatttataagacatattgtatctttgtgaggtg

 2.02 Intr +  43231  43390  160  0  1   72   99   163 0.594  15.36
aagtgctgggattacaggcgtgagccattggagctggcctctaagtgatgtttctgaagt
gttgatttatgttcatgtaagattaaacacacacagatgcttcacagctttaatgctact
gagtcctctttgtactttattagtccaacactctgctcagaacatgctttttcctggcag
TTGATCCAGTCCCCTGTGACAACCCCCCTTGGGCTGATCATGTTGAAGACAACTTCAGAA
GAGCTGGCTTGTCCCCGTGAGGACCTCAGTGTGGCTCGGAAGGAGGAGTTGCGGAAGCTG
CTACTGGACCAGGTGCAGACAGTGCTTGGGCTACTGACAG
gtgagcagtatggtagtgcccagagatagaggcctgcccgcaggcacccagagttcaggc
cttggcactcagcagctttgagcagttgtttgcgctgtttctgagatagcatgaaaatgg
gaagctgcgttcccaacacctatagcccagggtctagcacacagtaggactacaaaatag

 2.03 Intr +  46555  46632   78  2  0  111   44    32 0.460   0.62
agagccagaagatagctgtgaagtcgagaggcacagccgctagctggaggaggacatggt
caagaaagggatgttcaagtactcatgtttgatcagaggtatcaagaaactttctctaaa
tatgatttttatatgctggacattatttctcttataactctgtttctcctttcttggtag
GTATCTTGGAGACTGTCTGGGACAAACACAGTGTTACTGCTGCCACTCCACCACCATCCC
CGACCTCAGGAGAAAGTG
gtatggtctgcctgccagccaaggcattcttctttttaaatgtattgggggccaggtgtg
gtgatttgcaactgtagtcctcagtactgaggaggctgaggtgggaggatcactagaggc
caagagtttgagaccagcctgggcaacatagtgagactctatctctgtttttaaaaatta

 2.04 Intr +  56621  57074  454  0  1   83   80   380 0.733  29.02
aaatttcctaattagtgtttaactttgagcatatagattttatttttttatttcataggt
aactaaactgatacatatatgtatacatatatatatatatttttttttgaaggagaatta
cttaaagtcatttgtaagagatttgatgctggatagcttaaaagcctttcttattttcag
GTGACTTACTGAGTAACCTGTTGCAGAGTCCCAGTTCAGCCAAACTGTTGAATCAGCCAA
TTCCCATCCTTGATGTGGAGAGTGAGTATATCTGTTCCCTGGCTTTGGAGTGCCTGGCCC
ATCTCTTCAGTTGGATTCCTCTGTCTGCCAGCATCACCCCATCCCTCCTTACCACCATCT
TCCACTTTGCACGATTTGGCTGTGACATCCGGGCCAGAAAGATGGCGTCAGTTAACGGCA
GCAGCCAGAACTGTGTCTCGGGTCAGGAGCGCGGCCGGCTGGGGGTCCTGGCCATGTCCT
GCATCAATGAACTCATGTCCAAGAACTGTGTGCCTATGGAATTTGAGGAGTATTTACTGC
GTATGTTCCAGCAGACTTTCTACCTCCTGCAGAAAATCACCAAGGATAACAATGCCCACA
CAGTGAAGAGCAGGCTAGAAGAGCTCGATGAGAG
gtaatgaaaccaagtgtggagctggtgtgccccaagaaagggccctgactgtttaccatg
ctgtgctgcatggcatctgtaatcctctttgatttcagaatatggggctcctggtgagga
acagaaaggtaggtgtgtgccagtaagtctgagattagctggaagggcttgggtggttaa

 2.05 Intr +  57377  57436   60  2  0  121   65    36 0.663   2.45
agaaaggtaggtgtgtgccagtaagtctgagattagctggaagggcttgggtggttaagg
gaagtgactgagtttgaaaaatgcttgtgccttgtgtaggtttgttgtcttttctcccca
tccatctcctgtcctcccttctactcctcttgcccccttttccttactatttgcttgcag
GTCTGAGGTGGTGCAGGGACTGAGACTGCTGCTCCTGCGTAGCCAAGAACAGGAGAAGAG

gtccgtggaggtacaggagttataatcgccttttgtcacttggtgtcagtttttactatt
tgacttttcccaagtgaacatcctgcagtattcaggaatgttgttgttattgtgagtttt
acaccaatggcaagttttcatcaaactataggagggatgttaatgtgtgcacaggttaat

 2.06 Intr +  60364  60490  127  1  1   83  103    62 0.958   7.88
ggtggttaatggaatgaagggttgcctgtcctgtaggtaattgttgcaggcctttatatt
tttaaaagaaaatatattacaaatttgtatagttctgtactgaaagaactttggattgaa
tttaagttctaaggaggtggctgggtttcttattgtcaccttttgtcttgtctcatttag
CTATATCGAGAAGTTTACTGACTTTCTTCGGCTCTTTGTGAGTGTTCACCTAAGAAGAAT
CGAGTCTTACTCCCAGTTCCCTGTGGTGGAGTTTTTGACACTTTTGTTCAAGTACACATT
TCATCAG
gtaaagcaccaaagtcatccttcccttccagagaaaaggtttattaccttgttactttga
gaagaaagaactttttctttcaactttattttccaaacattaatataatgcttattatgt
gaagagtcacaggtttaatcttcctaacatccctgtgaagtaggttctattaccattgtc

 2.07 Intr +  66961  67070  110  0  2   79   97    70 0.982   6.08
ggttcaggagggcccaatggtatagaccgactaaaagccaccagttttggttaccaggaa
actggggaatctaggcttatgatttcatcattctgctggaattaaacactggcatgtgtg
tgtttctaaggaatagtagcattaaataatttcattgtctggattttttttgtaccatag
CCTACTCATGAAGGTTACTTCTCTTGTTTGGATATCTGGACGCTGTTTTTGGACTATCTG
ACAAGTAAAATTAAAAGTCGTCTTGGAGACAAGGAAGCAGTTCTCAACAG
gtaaactcctcaaacactgaaaactagatatggtcattttgccagttattctagtggcct
aagggacagccatgcatttggaccttttcagtgaagctgagtcatgtaagctgtttaggc
aataatgccattgagcatttccttttttttctcctttaagtattttgttaagacttttta

 2.08 Intr +  77839  77947  109  1  1   85   69   185 0.973  16.59
ctctgcttctcttccatgggcgcacacacgtaccaacccataaactcagcctcaggaatt
tcgatgctctttttccatggtgatcaacatagacaccatttcttttatagtgcaggaggc
attttccaaattctaagctgaaagcctcctttcaatgttgaatttctccctgccacatag
GTACGAAGATGCCCTGGTGCTCCTGCTCACAGAGGTGTTGAATCGAATCCAGTTCAGATA
CAACCAAGCCCAGCTGGAGGAGTTGGATGATGAGACTCTGGATGACGAT
gtaagcggcatgccctgattgattttttgtcgctgtcatgttgtgacatcaatcagaatg
gggacctggaacccagagccctctgctccgaagactgttctgaaaccagagtagtcttct
ggtttgagtcgtacatttgaaatttttaatctcctgctggtcccttttggcttattaacc

 2.09 Intr +  79230  79322   93  2  0   82   55    92 0.947   5.46
tttttgtgaaattaattcattgtttttaaaaaattctagcttggcctttttatagtacca
gataacctggttccatcattttccatttcttcaaaattttatgtctgagagtggtcttga
ggttggcaaggaagatgagaggattctgggagagctgattctcctgtgcttcccctacag
CAGCAGACGGAGTGGCAGCGGTACTTACGGCAGAGCTTGGAGGTGGTGGCCAAAGTGATG
GAGCTCCTGCCCACGCACGCCTTCTCCACACTG
gtaatgtgctgtccgggggagtggagagtgtagcgatttctctgtacacagagcatggct
ggttgactcccctggatctctctctctctcccctctttcccctctatgtaatttttaaaa
acagaataattaccataagtgatgctcaaactgaacaaatattaacatttccacaaaata

 2.10 Intr +  80970  81010   41  2  2   71   83    13 0.330  -3.88
atttgggattacaacagtttatagtcacttcagggtcaggtaaactggtttttattttct
aatttaaccaaacattcaaaaaaccatcggactgatatttcattactgctgccgttgctg
tcggaacatgatttcttcactgcagcctccccactggcatctctccccacttcgaaacag
GGAACGTTTTTAAAGGCTTATGATAAAAAGCTGTGGGGGAG
gtaaaagatgaggtcatgacagtgtattccaaggaggtgtttggaaaagaaactgatttg
gagtaaagagacaggacttactaaaaagcctctaattagtttccttatgtcctttcaacc
agcaggtgtactagggagaacatggccttgtgctttcttgcttcctgctcactttagaat

 2.11 Intr +  82832  82950  119  2  2   85   45    76 0.558   3.11
aaaggctattaacaaatggaaactctgagtacattttttcccctggttcccatagccatt
taccccctcaaataacctccatgccacaccagtcagtcagcctcatgaccctcagcagaa
actgtgccctctcatccctgataggctctgggccttccttcatttgcatttactttctag
CCCAGCCTTTAGTTCTTGGGTCTCCTCTGGAGCCTGTGTAAATGGGCGCCAGCCGCGATT
CTTGTCTACTCCTGGTGCTGTGACCGTGTATGACAATGGGATGCACATTTTGGCCAGCA
gtgaggcctgcagtgtggttacccagcctggaaggctcccacttttgcttttgtcagagc
agttggattcagaagatctcgtgcttctcactgtttcccttcctgctgctgagcctgcct
ccacttccctgtcaagaccaaggcacagcttgtcttgctgggccacgttggttgctctgt

 2.12 Intr +  87314  87473  160  0  1   91  102   319 0.994  32.65
taggtggataccgggcccagtttccctgctcagtactgggaagcagcccgtgggttgctt
tgtttcgcgaattggttttgctgctggttttgctgtgtgtggcttgctggaccagctgtt
atctgtagtatctaaagcgtggtcttcctgtgaaaaactgtctggcgtgttgtgttccag
GACACAGGTTGAACATCACGGCGGAGAACGACTGCCGGCGGCTGCACTGCTCCCTGAGAG
ACTTGAGCTCCCTGCTGCAGGCCGTGGGCCGCCTGGCCGAGTACTTTATCGGGGATGTGT
TTGCTGCACGGTTCAATGATGCCCTCACAGTCGTGGAAAG
gtaggctggcagttaccttatggagctgttccttcttcagagttcagctttaccttcttg
tgtgaggggcagcatattgccaaatagcttctgctctggccccgggtaaatctaggctct
gccacatacaagctgatagggaacaaattacttaacctctctgaacttcaggtccctcat

 2.13 Intr +  91400  91492   93  2  0  102   75    80 0.911   7.18
ataaatctttatgcatatctcagattatttccttggcataaaattgaaagtctggtcttg
attcttttttgtatatgaaaaagtctgcccttacgctctttgctggtaccagccttgtct
gttttgtctgtcttagttcataagctgaatgttcttgtttacctgcctctttgccaacag
GTTGGTCAAAGTCACTCTGTACGGATCTCAGATAAAATTGTACAACATTGAAACTGCTGT
GCCATCAGTATTGAAACCTGACCTCATTGATGT
gtaagtctagagtttgatgtttgtgcatttttaggaaagaccttgcccccaatctccaaa
taatttgattgagaaaaaggaacagtagtggctgccatgaatcagggaaaaactcttaaa
ctgcaaacctagaaagagagagagatttttttgactatatgtctggggcagaggcggttg

 2.14 Intr +  95700  95844  145  0  1  129   19   126 0.999  10.08
agatgatgaatatcttagtttttaggttctacgtgaaccggtaaatgatttctatgctgt
tgcccatgtcttagaacagcaaatgcagtggatgcaattcttacctcctatgaaaatgag
ttgaacgctaatatattttcaccttaacctttaaaatcacatcttcttttctttctgcag
GCATGCTCAGTCCCTGGCTGCGCTGCAGGCTTACTCTCACTGGTTAGCACAGTATTGCAG
TGAAGTTCACCGGCAGAACACGCAGCAGTTCGTGACACTCATCTCTACTACCATGGATGC
AATCACACCTCTAATCAGCACCAAG
gtctcgaaacagcaaagcctacaccttttatctaactctctgtctctccttctgttccta
tacccatttactagaaaatctaaatatgacacagagttagacccataaatctttctgctg
ttatacatctgttttatttcatgttcctttttagttgtagcctacatgcattcagataca

 2.15 Intr + 100115 100261  147  1  0  142  100   131 0.999  20.13
catgacagagaagatgggcttctcttgtagtcatcataggaaaaattcttgagctagata
gggcctaggtggtgtaatttggaaaccaagaatgacacatagcttgtggctgcctcagca
aagttcgaatcccagtcttacagggatgtggtgagctgacgtgccctcttccctctgcag
GTCCAAGACAAGCTGCTGCTATCTGCGTGCCACTTACTGGTCTCACTGGCCACCACCGTG
CGGCCCGTCTTTCTGATCAGCATCCCTGCAGTGCAGAAAGTATTCAACAGAATCACTGAT
GCCTCTGCCCTGCGACTTGTCGATAAG
gtgaggccccagagctcccccggggtccccagggctgtgtgactgagacccaaggaagct
gaggaagaagagtctggcctttgattttgtactcagagcttacaggctgtaccagcatag
acagatttcttattgtgtggcactgacacagactcagtgattctcatcgtgcccattcta

 2.16 Intr + 101159 101348  190  1  1   74   98   164 0.963  15.16
tcatcttcctccctaagctgccttccagttggaccaaaggccttgcccaggttgcaagaa
acgagcctgggggctagggttccaggtgtgcagccagcgggtgctgaaggctgtgttggg
catgccgcaccacggtctttggctctgacctctgatggatgcctttggggtctcttgtag
GCCCAGGTGTTGGTGTGCCGAGCCCTCTCTAACATCTTGCTGCTTCCGTGGCCAAACCTT
CCAGAGAATGAGCAGCAGTGGCCCGTGCGCTCCATCAACCACGCCAGCCTCATCTCTGCA
CTCTCCCGGGACTATCGCAACCTGAAGCCCAGTGCTGTTGCCCCACAGAGAAAGATGCCA
CTGGATGACA
gtaagtgacccctaggctaggacagctggggaaggaggtaggcaggcattgttctttgtg
gcagatgagatttgccccggaggctcctgaggtaaattttttttgttcatagtcccacag
aggctgagcaggaagtcatacttgggggtgggatcctgctacctttggaattcagttaag

 2.17 Intr + 105488 105643  156  0  0   80   91   165 0.989  15.98
caaaaactaaaacataaagagaggagaatttatattgtaatcaagagactgttcctttag
tgagactcgtgtgatcatcttcttggtacctttgcaagtttcctccctctcccttgtgtc
tcctcttaccatgctttctccccagacagcttataacctgcaactcatcttgatttgcag
CCAAACTGATTATCCACCAGACACTCAGCGTCTTAGAAGATATTGTGGAGAATATCTCGG
GGGAGTCCACCAAGTCTCGACAGATTTGCTACCAGTCGCTGCAGGAATCTGTTCAGGTCT
CCCTGGCCCTCTTTCCAGCTTTTATCCATCAGTCAG
gtaggagctggcccagaggccccactggtgggtggtgctaacaagggccagaatacccac
ttagatctgtagaacacactgagtcggtgcagtacaggccttgacttgttccgtgcaacg
aaacccggtactgaggggaaagggcagtgatgtttatttgtggagtctagggccaaggcc

 2.18 Intr + 106668 106782  115  1  1  113  115    44 0.999   9.11
gcatgtccctaatcgttttccactttccatcattggccctgatggtgttggggaaatgtt
tccagcaggaagctgtagagaaagctgatagtgcagatttcaggagtaggttgatgaagc
ccagggttctggttctcactgtgtgcaagcctctgacgatatctctgcccctttcctcag
ATGTGACTGATGAGATGCTGAGCTTCTTCCTCACTCTGTTTCGAGGCCTTAGAGTACAGA
TGGGTGTGCCTTTCACTGAGCAAATCATACAGACTTTCCTCAACATGTTTACCAG
gtaagcacagacccaccatctatagttttcagattcaagggagaagtggtgggtctggcg
acaaagtgtggctttttgctcctgttctgcacttgccacagcatgggttttcatgctggc
ccccagagaaacatgtggttgctcactgtgtggctttctcctctgtagagagcagttagc

 2.19 Intr + 106951 107122  172  1  1   95   75   236 0.999  22.95
catgtttaccaggtaagcacagacccaccatctatagttttcagattcaagggagaagtg
gtgggtctggcgacaaagtgtggctttttgctcctgttctgcacttgccacagcatgggt
tttcatgctggcccccagagaaacatgtggttgctcactgtgtggctttctcctctgtag
AGAGCAGTTAGCCGAGAGCATCCTCCACGAGGGCAGCACAGGCTGCCGGGTGGTGGAGAA
GTTTCTGAAGATCCTGCAGGTGGTGGTCCAGGAGCCAGGCCAGGTGTTCAAGCCCTTCCT
CCCCAGCATCATCGCCCTGTGCATGGAGCAAGTGTATCCCATCATTGCCGAG
gtaggggctcagacggtcccctgtgcagcaccccccatctccagattgggaagggaatga
gatttcacagaaaatgtattgtgttttaaagttcatttgttagtttaatatgcttgtaaa
gtagtttctcccaaggaagaaggcctttagtggtgtggtacagtgtttttatattgattg

 2.20 Intr + 108458 108619  162  1  0   82   97   201 0.981  20.57
caggcagtgacaggactccaggggctggatgtcttttgcgcaggtagtgacaggcatgtg
gatggagtgttgacactcggcttgctgtcacgaggcgtctcctaggcatctttgctgccc
tgggcccaggccggagcagctccgcaagctgcaggtctgagcgtctgtgtgtctttgcag
CGTCCCTCCCCTGATGTGAAGGCCGAGCTGTTTGAGCTCCTTTTCCGGACGCTCCATCAC
AACTGGAGGTACTTCTTCAAGTCCACCGTGCTGGCCAGTGTCCAGAGGGGGATCGCTGAG
GAGCAGATGGAGAATGAGCCCCAGTTCAGTGCCATCATGCAG
gtaacgtgggggcggggttgctgccaggtgacttcctctaacctgaccactgcagcgagt
cctgtcttcgaagccccacagtctcgggtctgaagctcagttctgcctgttagtattgat
gaagttaattaatttcttggagcctcagtttcttcatctgcaaagtggagctaatgttgc

 2.21 Intr + 111220 111318   99  0  0   67  115   115 0.982  12.41
cccggtggggaaaacatgaactctgagacttaggaggagcgtcgtagaggtctgagctgg
tgggccagaagcatcaagacaatgggtaccctggccctggcacttgttcttctgacatgg
ggtagatgctccagaagtgcttggtcttgcagtttataaaatggtggtctcatttcctag
GCTTTCGGACAGTCCTTTCTCCAGCCCGACATCCACCTTTTTAAACAAAATCTCTTCTAC
TTGGAGACTCTCAACACCAAGCAGAAGCTGTACCACAAG
gtaagtgccccagctcttggaaatattcttccatcaggggcattgtggcctgtgtcccac
cctcaggttactcactggagagtgtgacagaaagtggatgggacccgggacaggcccctg
ggggctggctgctgctcacctggtctctctgcctgcagaagatcttccggactgccatgc

 2.22 Intr + 111477 111707  231  2  0  114   76   417 0.974  41.07
caagcagaagctgtaccacaaggtaagtgccccagctcttggaaatattcttccatcagg
ggcattgtggcctgtgtcccaccctcaggttactcactggagagtgtgacagaaagtgga
tgggacccgggacaggcccctgggggctggctgctgctcacctggtctctctgcctgcag
AAGATCTTCCGGACTGCCATGCTGTTCCAGTTTGTGAACGTGCTGCTCCAGGTCCTGGTC
CACAAGTCCCATGATCTTCTGCAGGAGGAGATTGGCATCGCCATCTACAACATGGCCTCA
GTCGACTTTGATGGCTTCTTTGCCGCCTTCCTCCCAGAGTTCCTGACCAGCTGTGATGGT
GTGGATGCCAACCAGAAAAGTGTGCTGGGGCGGAATTTCAAGATGGATCGG
gtgaggagagaaagaggccgggctaagaggagggcagagtgggcacgcaagcctggcacc
tgtgcagcaaggagggggcacattgaggcctctgggcgtggtctgtgcccaccctgcagc
ttggcggcagctcacgagatgcctgctgacctggtgctgtagcctgattgaggggcacag

 2.23 Term + 114526 114627  102  0  0   75   47   156 0.536   8.48
ctcccacagcgcctggcacagagtctctgtgacacgcagtgcaacagtgaatagaagttt
tgagttttagaaagtgctcccctatcttcagtgcacactctgggatggaagtagctgttg
gggtctggtgggtgggtgacctggtgtgttgttggctgcagctatgcccctgccttccag
GACCTGCCCTCATTCACCCAGAATGTGCACAGGCTGGTCAACGACCTGCGCTACTACAGA
CTCTGCAACGACAGCCTGCCCCCTGGCACTGTGAAGCTCTAG
gcctgctactgcctggggacacggacttctgctgctgccacctgcgccagccctaccttc
caccacagatgtctcccagatgggccttggtcacactccttggcttctcccaccgcaagc
aacgctgcctgcctctgccgctcctccacatcttgccgctgcccagcagagctggcttct

Predicted peptide sequence(s):


>XPO6_1|GENSCAN_predicted_peptide_1|241_aa
MAGRESTRLEPVLALLSLVCGTVGKPRKLLEHSSSVLADTVISPSLHQPKAKTDQKSNTL
LLPGPFHPQQVAGQQWEPSALNDWGSRGMITSELYEAAQQYGRWTEGRRTWKRGPVMTAT
TKARDNDSLIKAEGMEGKPQPTRPLPPPPRASLRAPALEPPASTARPPPTNSPNAPEVAS
AGRPHSAAAGLRRWNRTNPESSGASGGSGRRAEGGAAPDGSHWPRLLTTPSLAPPPAPTA
X

>XPO6_1|GENSCAN_predicted_peptide_2|1091_aa
MEIRSCLPKLLLAHHKTLPYFIRNKLCKVIVDIGRQDWPMFYHDFFTNILQLIQSPVTTP
LGLIMLKTTSEELACPREDLSVARKEELRKLLLDQVQTVLGLLTGILETVWDKHSVTAAT
PPPSPTSGESGDLLSNLLQSPSSAKLLNQPIPILDVESEYICSLALECLAHLFSWIPLSA
SITPSLLTTIFHFARFGCDIRARKMASVNGSSQNCVSGQERGRLGVLAMSCINELMSKNC
VPMEFEEYLLRMFQQTFYLLQKITKDNNAHTVKSRLEELDERSEVVQGLRLLLLRSQEQE
KSYIEKFTDFLRLFVSVHLRRIESYSQFPVVEFLTLLFKYTFHQPTHEGYFSCLDIWTLF
LDYLTSKIKSRLGDKEAVLNRYEDALVLLLTEVLNRIQFRYNQAQLEELDDETLDDDQQT
EWQRYLRQSLEVVAKVMELLPTHAFSTLGTFLKAYDKKLWGSPAFSSWVSSGACVNGRQP
RFLSTPGAVTVYDNGMHILASRHRLNITAENDCRRLHCSLRDLSSLLQAVGRLAEYFIGD
VFAARFNDALTVVERLVKVTLYGSQIKLYNIETAVPSVLKPDLIDVHAQSLAALQAYSHW
LAQYCSEVHRQNTQQFVTLISTTMDAITPLISTKVQDKLLLSACHLLVSLATTVRPVFLI
SIPAVQKVFNRITDASALRLVDKAQVLVCRALSNILLLPWPNLPENEQQWPVRSINHASL
ISALSRDYRNLKPSAVAPQRKMPLDDTKLIIHQTLSVLEDIVENISGESTKSRQICYQSL
QESVQVSLALFPAFIHQSDVTDEMLSFFLTLFRGLRVQMGVPFTEQIIQTFLNMFTREQL
AESILHEGSTGCRVVEKFLKILQVVVQEPGQVFKPFLPSIIALCMEQVYPIIAERPSPDV
KAELFELLFRTLHHNWRYFFKSTVLASVQRGIAEEQMENEPQFSAIMQAFGQSFLQPDIH
LFKQNLFYLETLNTKQKLYHKKIFRTAMLFQFVNVLLQVLVHKSHDLLQEEIGIAIYNMA
SVDFDGFFAAFLPEFLTSCDGVDANQKSVLGRNFKMDRDLPSFTQNVHRLVNDLRYYRLC
NDSLPPGTVKL