GENSCAN 1.0	Date run: 15-Jan-104	Time: 12:40:48

Sequence WFDC1_1 : 37448 bp : 50.28% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +   1315   1521  207  2  0   92   86   152 0.989  14.45
agacgccctggttggagcgtctggggccagatgttatagggcaagctaaaaataaccggg
caggccagccaccatcgaggaaggggcatgtgctggacgcggacacatgatccgagggac
cctgctgggtggaactaagaaagtccagcagactgtgcacgctcctgtccccactcacag
GCCCACGCAGCGAGGGGGGCCCCTCTTCTGTGTGCGTCTGGAAGGTCGCTGCCCAGGGAG
GAAATGCCTTTAACCGGCGTGGGGCCGGGCAGCTGCAGGAGGCAGATCATCCGGGCTCTG
TGCCTCTTGCTACTTCTCCTCCACGCCGGCTCTGCCAAGAATATCTGGAAACGGGCATTG
CCTGCGAGGCTGGCCGAGAAATCCCGT
gtaagtgcctgggatggggaggctggggcagcctgtgtgggtgggagtcagccttgagga
gaggcgatccctagacactgccttctcctgtaagtgctcccccaaaacgtggcaaggcag
gcgtcttcctatccgtgtgtgtctgagttgtgtggtgggcagatggggctcacccccaaa

 1.02 Intr +   5948   6048  101  0  2   32   39    79 0.187  -2.77
tctcaaaaaacaaaaaacaaaaagcaaaaaaaaaaaaccaaaaaccccattccagaacca
aatatttatgagaatgaataaaacagaagcagaacgtttgtaaatagtccaataaccttt
ccatggagctcagtcggttctgtggacttggtgtttttggtttttctttcctggcattag
ATGAAACTCCTGAGAACAATGATTTACTGAGCGCTTACACTGTGTCAGGGCAAGAGTTTG
CCACGTATTCGCTCTTGGGAGCCTCTCGACAAATCCACCGG
gtggggcccatggcagccaccatgcgggcctcggtgctatgcagcccctggcctgggcag
gctggcccctactgtcagtgtgactgtgggtctgttttcccctctaagcacccctccagg
gcagctggaaatggtggttcagtttgcaccctgcccagagatgcctgtcctgctgagggg

 1.03 Intr +   7687   7887  201  0  0   49   99    38 0.318   0.48
catgagggactgccagccaccactggaagctgggagagacattgaaaggttttctcctta
gagcctccacaaaggaaccaaccctgccagacacctggatctcagccttctggcttccag
aactgtgaaagaatccacttgtgttgttttaagcccccagcgtgtggcattttgttgcag
CACCCTCGGACACGAATACAGTCTGCTCTGGGCATCAAGGGAGTCAGCTTCTGTTGGTTG
CAACCGGCAACGAGACATTTCACAGATAAGGAAACTGAGGCCATTGCAGAGAATGACTTA
TCTGTGCTGTTTTGGCTGGGGACAAGTGGGGCTATCACTATATCCCCAGAGTCTGGGAGC
TTTGTCTGCTCCTTGAACCAG
gtgagctcacaccctgcgggacttcatcatcaagactatgaagatgcctacgtcttgggg
gtcagcgggtgctcagtaggctccggaaacccccagcagcacccaggagggggtcttcaa
ggctcatggttgagaaccccagaaaagccccggagctgcctgggtgctggagagagggga

 1.04 Intr +  13067  13274  208  1  1   72  110   153 0.729  14.55
tccagctttacattttgaaagcatccttcctcatctctggagtgtgggatatcaagaccc
actcccctaattcacatccgcattaagtgagcataggagtgtgatgatgcttgcccatag
cacagccttacacaaacaaaagggctgcccccacacctgtgcaggacccctgctctgcag
AACCCACTGCACAGGGCCCATGTGCAGATCAGCGAGTTAATGCATGTTAAGCACTTAGAA
GGGTGCCCAGCAAACTGCCAGGGTGTGTTGACCACCATCATCCTCATCTTCATCATCATC
ATCATCATCACAGCTTTTGTTCCACCCGAAGAATATTTACTGAGTACTTGCTATGTGCCA
GGCACTGTTCTACGAGCCAGGGACACAG
gtaagaacaaaaccaagttcctgtccctaggagggagaaaaacagcaaacaaatgagttc
ataatacacagtccacccaagggtgatgaggtgtgtgaagctccacaaagcagggagagg
gggaagggaaggctgtatgagcagatcccaggtaggtgagagccgggcagatatggtggg

 1.05 Intr +  15021  15385  365  1  2   18  -53   441 0.063  17.90
tggcgagggcctaaaaatgaagaatcatactagaaacatcccgacgagtctggggaaagc
tgccctcagaaggctgtttaagctgaggactaaagggtgatttggccaattgaagctgat
gggaggccttccaggcagaggaccagcacgtgccaatgatgatcggtggcactgtgctag
ATGCCAGCCTGAGTGTAGATGCCCGCCTGGGTGTACACTCCATCCTGAGTGTAGACACCA
GCCTGGGTGTAGACGCCATCCTTGGTGTAGATGCCATCCTGAGTGTAGATGCCAGCCTGG
GTGTAGACGCCATCCTGAGTGTAGATGCCAGCCTGGGTGTAGACGCCATGCTGAGTGTAG
ACGCCAGCCTGGGTGTAGATGCCATCCTCAGTGTAGATGCCAGCCTGGGTGTAGATGCCA
GCCTGGGTGTAGACGCCAGCCTGGGCATAGATGCCATCCTGGGTGTAGACACCAGCCTGG
GCATAGATGCCATCCTGGGTGTAGACACCATCCTGGGTGCAGACTCAGGATACCCCAGGA
GGGAA
gttctgtagggagaaactgatgcttgcccaaggtcacacagcaagtgagtggcagagagg
atttaagccctagagccgggatttgaaccaaggccgttagctgtggagcccgctctggtt
gcccgtctgctctgccggatgagacaagctcagctggaggaaacggtttgaagagatgaa

 1.06 Intr +  19367  19559  193  1  1  123   96   248 0.973  28.17
tggtatcttctgaccttctgagccgccctccgaggctggctctgcctgcttgctgtttct
cacaagaggaaacgcaggctcagagaggcccggcgcactgcccacccccttgcaagctcc
gggtggcgccgggactcgaacgcgcgccccagagctgctgacaccgccctctccccgcag
GCCGAGGAGGCGGGCGCGCCCGGCGGCCCCCGGCAGCCCCGAGCAGACCGCTGCCCGCCG
CCTCCGCGGACGCTGCCCCCCGGCGCCTGCCAGGCCGCGCGCTGTCAGGCGGACTCCGAG
TGCCCGCGGCACCGGCGCTGCTGCTACAACGGATGCGCCTACGCCTGCCTAGAAGCTGTG
CCGCCCCCGCCAG
gtaggtcctgggcccgagggagggggctgagggaggaggacaggtgaacagagctgtccc
gggggaggggaagaaaggagctgggcttaaagctgggccacctgggcgggtctcgggcgc
ctccactgcgcacctgtgaactgggacgggcgctccttgagcaggcgtggcgctgctgtg

 1.07 Intr +  24684  24761   78  1  0   61   77    93 0.820   5.02
acagtgaaaggttctatcactaaaagcaaagggtgaaggtgtgccaggaaccatagttat
ttctcccatggggagcctctgtgctgtcatgaagttggggtgcccccagcccccaagcct
gggcgtttctcagctgcttgaggagggccctgatctgaccccgtattgtgttagtcttag
ACTGGCTGGTGCAGCCGAAACCTCGATGGCTTGGTGGCAATGGCTGGCTCCTGGATGGCC
CTGAGGAGGTGTTACAAG
gtacctgccgggtaaagcccagaccctacatccaagcctcgatccctccttctcagctgc
ttccagaaagctggcagcaccaggccggctgtcccccatgcacgggcccttcagccaaac
actcagccctctttgatcctccccaccccagcgaagaagggctgatggctgggggcttgg

 1.08 Intr +  25542  25727  186  1  0   44   68   118 0.896   5.06
gtgactgtattgtgagtgtacatgtgtgggtaagcgtgtgtgtatgtgggtgtggatatg
tgtgtgcaggatttgtgtgtggggatgcgtgcgtatatgtctgtgtgtatttgtgcgtct
gacttgcttgtgtaaatgtctgtgtccccatgcgactgtagggctgagtgtgtgtttcag
GGTGTATCCGTGAACATGTCTATATGGATGTTGCTGAGCCTGTGAGAGTATGTTTGGGAT
CAGGTGAGCTTGGACTGCCTGTGTTTGTGTGCGTGTTTGTGGGTGTGCACGTGTGCCACA
TGCCGCTGAGTGAGACCCAGGGCCTAGCCTGGAACCTGGGGTACAGAGGCGAGGCCGCCT
CTCTGG
gtgaggtgcgttccctgcacccgtcccgggagtctgccttctagaccctagcatgtgcac
ctgtcctgggagtcggccttctagaccccagcgtgtgtccctcctgcagcagaggcgtgc
agcaccacggaggatggggccgaacccctgctctgtccctcgggctatgagtgccacatc

 1.09 Intr +  25837  25977  141  2  0   57  109   186 0.545  17.92
ccacatgccgctgagtgagacccagggcctagcctggaacctggggtacagaggcgaggc
cgcctctctgggtgaggtgcgttccctgcacccgtcccgggagtctgccttctagaccct
agcatgtgcacctgtcctgggagtcggccttctagaccccagcgtgtgtccctcctgcag
CAGAGGCGTGCAGCACCACGGAGGATGGGGCCGAACCCCTGCTCTGTCCCTCGGGCTATG
AGTGCCACATCCTGAGCCCAGGTGACGTGGCCGAAGGTATCCCCAACCGTGGGCAGTGCG
TCAAGCAGCGCCGGCAAGCAG
gtgagtgtggcaccccagccctgatcctggctcctgccccagtccccttctccctgtaag
cgcctctcacccgcatggacgacctgccccaggaagcagccccagcacctgggcctgact
gagagctcctcacatcttccccctgcccggctccttctttcatggcccctaccctttccc

 1.10 Term +  26038  26099   62  2  2   60   54    84 0.887   0.17
aggatggggccgaacccctgctctgtccctcgggctatgagtgccacatcctgagcccag
gtgacgtggccgaaggtatccccaaccgtgggcagtgcgtcaagcagcgccggcaagcag
gtgagtgtggcaccccagccctgatcctggctcctgccccagtccccttctccctgtaag
CGCCTCTCACCCGCATGGACGACCTGCCCCAGGAAGCAGCCCCAGCACCTGGGCCTGACT
GA
gagctcctcacatcttccccctgcccggctccttctttcatggcccctaccctttccctg
tcacactagcatgtgaccgaagctcttgagccagcagactggctgcaaaccccagctctg
cacctcccagctgggcgacactggggttaatttcttcctatctctgagcctcagtttcct

 2.02 PlyA -  28828  28823    6                               1.05
 2.01 Term -  36805  36645  161  2  2   69   48    96 0.571   1.80

Predicted peptide sequence(s):


>WFDC1_1|GENSCAN_predicted_peptide_1|580_aa
XPRSEGGPSSVCVWKVAAQGGNAFNRRGAGQLQEADHPGSVPLATSPPRRLCQEYLETGI
ACEAGREIPYETPENNDLLSAYTVSGQEFATYSLLGASRQIHRHPRTRIQSALGIKGVSF
CWLQPATRHFTDKETEAIAENDLSVLFWLGTSGAITISPESGSFVCSLNQNPLHRAHVQI
SELMHVKHLEGCPANCQGVLTTIILIFIIIIIITAFVPPEEYLLSTCYVPGTVLRARDTD
ASLSVDARLGVHSILSVDTSLGVDAILGVDAILSVDASLGVDAILSVDASLGVDAMLSVD
ASLGVDAILSVDASLGVDASLGVDASLGIDAILGVDTSLGIDAILGVDTILGADSGYPRR
EAEEAGAPGGPRQPRADRCPPPPRTLPPGACQAARCQADSECPRHRRCCYNGCAYACLEA
VPPPPDWLVQPKPRWLGGNGWLLDGPEEVLQGCIREHVYMDVAEPVRVCLGSGELGLPVF
VCVFVGVHVCHMPLSETQGLAWNLGYRGEAASLAEACSTTEDGAEPLLCPSGYECHILSP
GDVAEGIPNRGQCVKQRRQAAPLTRMDDLPQEAAPAPGPD

>WFDC1_1|GENSCAN_predicted_peptide_2|53_aa
XGGAASPPTDGCWKRYAYSGSAVQPQWDRLHSVAQGYRHHLQNEQAGPLFNND