GENSCAN 1.0	Date run: 15-Jan-104	Time: 13:07:13

Sequence TSC2_1 : 42520 bp : 60.13% C+G : Isochore 4 (57 - 100 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +    385    668  284  1  2   34   98   215 0.286  15.42
ttgcagcccctgcccgcgcagctgggagccgcaggaggcggcccgggactccagcctgca
gcccctatcccgcctcctcccacgctccagccacggcgcggcgctacctgctgcagcctc
tcttctccggagaggcccgggctcctccctacacccccgcggcccagccccgggtcccag
GCTCCGGCTCCGGGTCAGCATCCTCGCGCTCAAGGCGGTCATGCCGGACTCCTGCGGACT
ACACATCCCGGCGGCCCATGCGGCCCCGTCACGTGATGCAAGGATCGCCGGCCTTTCCGC
CAGAGGGCGGCACAGAACTACAACTCCCAGCAAGCTCCCAAGGCGGCCCTCCGCGCAATG
CCGCTACCGGAAGTGCGGGTCGCGCTTCCGGCGGCGTCCCGGGGCCAGGGGGGTGCGCCT
TTCTCCGCGTCGGGGCGGCCCGGAGCGCGGTGGCGCGGCGCGGG
gtaagtggcggtccccacggggcaagtggcggtccccacggggcagcggcctagagaggc
ggaccccgcagtgtccgggtcccgggccctcacccgcgcccactgcaacccgactccgga
gctccgagcatcccttagttttaagtcatggcgggtgcgaacgggtctctgctgcaggcg

 1.02 Intr +   1190   1356  167  0  2   73   70    71 0.819   4.68
gctttcctaggtgcctgtttgcgagctggtcagctgggctgtagttgagttctcccaggg
agtgtgggaggaaaggttatgcccaccagagacccagggtcctgacggctggaggtccgc
agtggggaaggtgggcagaggtgttgctcagatgtccccattcctgtttcgtttgcacag
AGGGGTTTTCTGGTGCGTCCTGGTCCACCATGGCCAAACCAACAAGCAAAGATTCAGGCT
TGAAGGAGAAGTTTAAGATTCTGTTGGGACTGGGAACACCGAGGCCAAATCCCAGGTCTG
CAGAGGGTAAACAGACGGAGTTTATCATCACCGCGGAAATACTGAGA
gtgagtgagctacctgtgtctttgctaggctagagggaaatgcagagaaggctgggtttg
gtcttgcaccaggttctgtgggagacgggttgctggcaactgtctacacaggaatgctgt
ctccagtacttggaggccgacatgtccttcctcaggagacttcgaaagtcaggatcttgg

 1.03 Intr +   3003   3089   87  2  0  122   92   143 0.990  19.42
gtgcagggattacaggcctgagccaccgcggctcgtcaagtgaatcttgattccagaaag
atctgttttaagtctctagtctggaaaatgcagtgggagtctttaggtggtttgtgactt
gcagttaaggagaccgtggcctgagcactggcccctttttcttctttcatctctctccag
GAACTGAGCATGGAATGTGGCCTCAACAATCGCATCCGGATGATAGGGCAGATTTGTGAA
GTCGCAAAAACCAAGAAATTTGAAGAG
gtaggtttatccagttgagctactagagagaggcacgtagactattcagagcctgagttt
gctttttttaggaacatggttgacagctgactgccgatgatctggtttgcactttttttt
tttttttttttttgagatggagtcttgctctgtcgcccaggctggcacaatcttggctca

 1.04 Intr +   5945   6055  111  1  0   76  110   151 0.994  17.84
cgaagcctgtggtcatctcaggctgcaggagacacaggagatacgagctttggaggtggg
gctctcagtcacaagcccccgttgttcctccctgtcctccgctcacggcactgctccagt
tgccggggccagggttcttggagagcacatcctcaccgctgtcccctctgctggtgacag
CACGCAGTGGAAGCACTCTGGAAGGCGGTCGCGGATCTGTTGCAGCCGGAGCGGCCGCTG
GAGGCCCGGCACGCGGTGCTGGCTCTGCTGAAGGCCATCGTGCAGGGGCAG
gtaaggcccagggcgacgctgggatgggtgacgtcaggctgcccactgactgtcctgtcc
ctgctgggccgtgtttggactcctgcctcggtgagttgctgggcacagggtctaggggct
gatgggctctggagctggatggcctgtggggtctcctggtgtcatgaggtctgtgtgacc

 1.05 Intr +   6899   7043  145  1  1  108   55   132 0.954  12.94
gcatccggccccctgccctgtacaatgctgatgctgcagacctgtctcttgcagggcgcc
tctgtgggaaggagaggggtccagggctggagtccgggtgcccctgcacttcagggactt
cttggcagccgtgtgggcgacgctggcaggctctgctgatcctgtggcttttgtctttag
GGCGAGCGTTTGGGGGTCCTCAGAGCCCTCTTCTTTAAGGTCATCAAGGATTACCCTTCC
AACGAAGACCTTCACGAAAGGCTGGAGGTTTTCAAGGCCCTCACAGACAATGGGAGACAC
ATCACCTACTTGGAGGAAGAGCTGG
gtgggtgccaccttgggttggaggtttctctggccttgacgatcaagtgtaacctggatg
ggaaggacctggggctggggaggggctgccgttctcagggatggcctgcagcgggtatgc
ccaccctgcttcatgcacctgggctcacctgcgtggccggagtgcccctgaggcacgtgt

 1.06 Intr +   8005   8122  118  2  1   95   52   130 0.912  10.80
gccctgggctcccctgagcctcttcgggcccagtgcgtggtctgtctgttgctgccgggg
gactgatgatggggtttctggcagtgacgggtttggacacactgtcctgcggcgggaggg
ggaggtgagtgggagatgtagattcggcgtcctcgcaaactgccgccgcttctcccccag
CTGACTTTGTCCTGCAGTGGATGGATGTTGGCTTGTCCTCGGAATTCCTTCTGGTGCTGG
TGAACTTGGTCAAATTCAATAGCTGTTACCTCGACGAGTACATCGCAAGGATGGTTCA
gtaagaaaagaattgagatcctgttctgataatggtcctaagttcagctccgcagtgaat
aaagttgaaaccaccaaaaaaatagaggttgggctgggcacaatggctcacgcctgtaat
ctcagcactttgggaggccgaggcaggcggatcacgaggtcaggagttcgagaccagcct

 1.07 Intr +   8799   8847   49  0  1   80   78    29 0.911   0.92
cccagcaccgagagcagtggctggcgcacagcaggcacctgagtgcttgttgggtgggtg
ggacccccagggaggatgagccatgcgtgttattgacgtcatagagtgactagaccacag
cccgtggtggctcggccatccaggcagtgctgccgggactgagctcggtgctccctgcag
GATGATCTGTCTGCTGTGCGTCCGGACCGCGTCCTCTGTGGACATAGAG
gtcagtgcctcccctccccagggccggcccatttcaccctggtttctgggaggctggggc
ttgggggttgagccctgtgtgccacctgctggctgtgtagccctgggcaagctgctcggt
ctctctgagcctcaggagtcccccatgtaagtcaggatagccgggcgcctccatgtggag

 1.08 Intr +   9247   9372  126  0  0   79   81   247 0.755  25.15
tgacagggacgtcaggtgcttcccacatgcccgcttgccctgtggcttggagagagggtg
ccatggcagcggggagaggtggcagcgcaggctgaaggaggtgggaaggaagcctgggtg
tcctctcctgtggggaggagctggggtaggacgggcgtgagccgtctccctctccaccag
GTCTCCCTGCAGGTGCTGGACGCCGTGGTCTGCTACAACTGCCTGCCGGCTGAGAGCCTC
CCGCTGTTCATCGTTACCCTCTGTCGCACCATCAACGTCAAGGAGCTCTGCGAGCCTTGC
TGGAAG
gtggggtttctgaaactgctctggaaggttcctgagagcacatggatgggacaagggcca
tcctgtctcccatgaatggttgtctgattcttggggtggccagacaatggcctgttgagg
gacggccagtgtcattttcccaggcagttgagctgaggtcagggttttggtggcattttg

 1.09 Intr +   9708   9781   74  2  2   94  109   112 0.976  13.25
aggtcagggttttggtggcattttgagaaccctgctgcctctgtctttgggaggagatgg
tggcgagctggccggaccttgggtggctatagggcagcagccaggcggggccagcagcgg
gactggggctgggggcagggcttatgcctgccagcccctgacacgcattgtgtctcgcag
CTGATGCGGAACCTCCTTGGCACCCACCTGGGCCACAGCGCCATCTACAACATGTGCCAC
CTCATGGAGGACAG
gtgagtgtggtgggtggggcgcagggcagtggaggccagcacagccctcggggcagctcc
agtgtcccttgccaagcacacactggcttagagagtccttgtcctctcgggcagctgttc
cagaggctgccactagagcgaggcccatgacttctaggatccagcccctgtcctctcctt

 1.10 Intr +  11350  11476  127  1  1   23  110    85 0.845   6.06
gagtgaacaagagtgttactgctggcctctgttccctgcccttccccagcggtgctcctg
ccccccccaagcacagggacctctggggctgctgcaggagcctcggcaacctcacacatc
catggcggaccctgggacagggccctgctcacattccgtctctctggggaacacttttag
AGCCTACATGGAGGACGCGCCCCTGCTGAGAGGAGCCGTGTTTTTTGTGGGCATGGCTCT
CTGGGGAGCCCACCGGCTCTATTCTCTCAGGAACTCGCCGACATCTGTGTTGCCATCATT
TTACCAG
gtaaggcggtttctgtgtgcagtgagctggcaggaacgggagagctcccctcacgcctgc
ccacccatcccactgggggtcctgctgcgggggctgcggtggcatttctaggcctttcca
ggcagttgctttgcagctgggggtgaggtttggggccctttgtaggctttagtctttttt

 1.11 Intr +  12927  13031  105  2  0  125   30    14 0.588   0.88
agcttcagtttccgcagtgccccgtgatgacagcgctttttgtgtccgtcctcgttctgt
gctcacagctccctggagggtggggcgatcacgtcgtcctggttttatagtgatgagctg
cggtgtgggtcacagggctctcctgatcctctgctcttcctgctacccccctccccgtag
GGGCGGTGGGGGGATGTTGTCTTTGTGCACAGCTTGCAGCCGAACTCAGGGCAGCTTTCA
GTTGCTGCTGGGCTGGCCCACCGGGTGCCCAGGATTCAGTTGCTG
gtctgtccgagtcagggactttgcaggcaggcatgggggtggggcccgtctgggtcctga
ctgtgctggagcatgtagaaacccctcctgggcgccccacctgctgtttctgcggcccct
gataaacgtgtggtgggcactgcgggctcaggcgtgctactctcggtcccaagggtgact

 1.12 Intr +  13276  13419  144  0  0   88   75   203 0.998  20.66
gctggagcatgtagaaacccctcctgggcgccccacctgctgtttctgcggcccctgata
aacgtgtggtgggcactgcgggctcaggcgtgctactctcggtcccaagggtgactggga
gggcgtcccacagcaagcaagcagctctgaccctgtgtgctggccgggctcgtgttccag
GCCATGGCATGTCCGAACGAGGTGGTGTCCTATGAGATCGTCCTGTCCATCACCAGGCTC
ATCAAGAAGTATAGGAAGGAGCTCCAGGTGGTGGCGTGGGACATTCTGCTGAACATCATC
GAACGGCTCCTTCAGCAGCTCCAG
gtggggtgggggcaggagctccggggagcaccgggaacccagacaggcaggctcggccca
ctcagaagatggtaccttgggccccatctctgggggtcccgcagagactgccagaaccgt
gttctctggtgattcgcagtggcgctcatccaccttccaccggagacaggtctgattttt

 1.13 Intr +  14477  14614  138  1  0   54   39   219 0.919  15.44
gtctcaacccatgaggcccggagcggcctcagagggctgggggcgtctgtccccatgcgg
cccagagcggcctgagagggctgagggcgtctccatgcggtgggtgtgtagcgaggcctc
tggtgccaagtccatgtggggagtggaagtcagcctgtgtcatcgtgcctggtactgcag
ACCTTGGACAGCCCGGAGCTCAGGACCATCGTCCATGACCTGTTGACCACGGTGGAGGAG
CTGTGTGACCAGAACGAGTTCCACGGGTCTCAGGAGAGATACTTTGAACTGGTGGAGAGA
TGTGCGGACCAGAGGCCT
gtgagaccccctcctgggtggggcctttgggctttggctggtggggaggggccgggtgct
gggtgaagtgcagctttctgagcctcagaagccaagggccaggtgggcgcctgctttcca
ggtttctgcactcggcagggaaggctggcaggcacagcacgtgtttggtaacaagctcgg

 1.14 Intr +  15103  15206  104  0  2   65   91   116 0.952   9.74
tccatgggtttggacacaagtcttccccgctgccaggagtgcctttgtgtctgggctgtg
ggctgcaggctgtgaggcggctgggctctgacagcaaaccagcctctcgaccagcagccc
agtgtggagaaggagagcgccggaggggcagaggggcaacaccggctcttcttttgacag
GAGTCCTCCCTCCTGAACCTGATCTCCTATAGAGCGCAGTCCATCCACCCGGCCAAGGAC
GGCTGGATTCAGAACCTGCAGGCGCTGATGGAGAGATTCTTCAG
gtagggggtcctctgtagccttgcctggcacctggagcctggccctgtctctgtctgggg
cccacccgggctgggtctcaggatgcccgatgagcagggccctcccctctgcctctggag
agccctggctctgggtgagcaggtgctagcttgctttccagtccagcaggacaggtcctc

 1.15 Intr +  15578  15659   82  2  1   77   92   168 0.692  16.89
ctgggctccctcttttcgggggtcgtctggagagatgctccctgggaagcagagctctgt
gccctgtgtgcctggccgcgggaggacccagagtcgggctggcctgcgccaggcagacgg
gctggtgtggggctgtggccgggcactccccacccgccccagcaggctgccgtcccgcag
GAGCGAGTCCCGAGGCGCCGTGCGCATCAAGGTGCTGGACGTGCTGTCCTTTGTGCTGCT
CATCAACAGGCAGTTCTATGAG
gtgcgtgtccaggcggccgcagctgggggctcagggctatttctccgtgggcgggctgtc
tctgttgtgcacgtgctcccgcagagccgggctctgcctgggacttcggtcctgccggac
cctctgcagcccccagcgtggtctgtttacccctgttcattcactggcttgctcgtcctg

 1.16 Intr +  16878  17033  156  2  0   91  100   281 0.992  31.00
ggaaggggccccggggtctctgagtcgcgctcagcgggtgcttgtgctctctgcccagct
gtgctgaagtcccgagggacatgtccgctgcttgcgggtcggttcctgaggaattggaag
tgtcacgagatgtggccctcgttgggctggcgctcattggcctcccttgtgcctgtgcag
GAGGAGCTGATTAACTCAGTGGTCATCTCGCAGCTCTCCCACATCCCCGAGGATAAAGAC
CACCAGGTCCGAAAGCTGGCCACCCAGTTGCTGGTGGACCTGGCAGAGGGCTGCCACACA
CACCACTTCAACAGCCTGCTGGACATCATCGAGAAG
gtgagagccgttgtacccggggccgggtgctagcgtgccagagctccgtgggcagcaatg
gcctctgggccctctgtcctcctcttcgagtgaccggatggctgtgtccgtaggtgaggc
tcccctccctgcagggtgggtgtcccgaggcctgtgcagggcctgccactgctggatttg

 1.17 Intr +  18125  18241  117  1  0   71   94   159 0.961  16.63
ggaggcggagcttgtagtgagctgagattgtgccaccgcactccagcctgggcgacagag
caagactcgatctcaaaaaaaaaaaaaaaaaaaaaaaaggtgtttgtggtagaaagtgtt
ctcacggctgctgactcagaaccatgagcctgtgtgtaagtcctggccttctcttcaaag
GTGATGGCCCGCTCCCTCTCCCCACCCCCGGAGCTGGAAGAAAGGGATGTGGCCGCATAC
TCGGCCTCCTTGGAGGATGTGAAGACAGCCGTCCTGGGGCTTCTGGTCATCCTTCAG
gtgggtgttctgcacgaggcctctgctcccggggcgcgcatggctagcgtccaccagctg
catctgcgttgtgttggagtctgttccccagcgggacccacaccctccctggatttgctg
agggtgcggtggtctcagcaggcagcagaaccttcctcctgctcttgtggagggatggat

 1.18 Intr +  23066  23188  123  1  0   93   80   150 0.661  16.66
tgggttttactttttgctgctgtggagagagagtcctggtggtcctgggtttgaaggtcg
tgtgttttgaagcacgcactctagagcagccgccccggcccctgctccgggacaagggtg
ctgtcttaggactgcgttttcacctcctgcgccgtggtgagctgcgtcctctctctgcag
ACCAAGCTGTACACCCTGCCTGCAAGCCACGCCACGCGTGTGTATGAGATGCTGGTCAGC
CACATTCAGCTCCACTACAAGCACAGCTACACCCTGCCAATCGCGAGCAGCATCCGGCTG
CAG
gtatggtggctggggttgcgcagccagttcctgggggcccagccaggtatccccgtctcg
gcaggtgtggttcctggaagctgcagagacggccccaggatggggcctcagctgaccgtc
cctcctctgcacccactgtggccgcagcctccccagtcctggtgtccttccctctgcctg

 1.19 Intr +  24120  24286  167  2  2   92  -12   275 0.634  17.86
gggcctccggtgtcaccaggacagagcctgtgtctgtgttgggatgtgggtgtgtgcaca
tcagcaggtggccttttctgagtgcctgtggtgctggacgtgggtctgagcaggtgggac
gccgcctgtcctgggcctgcacgagcttggctctggctttcaccatcctcttcctgacag
GCCTTTGACTTCCTGTTGCTGCTGCGGGCCGACTCACTGCACCGCCTGGGCCTGCCCAAC
AAGGATGGAGTCGTGCGGTTCAGCCCCTACTGCGTCTGCGACTACATGTACGCGGGACCT
CGCCCACGGCCCATGAGGCTCAGGGCGTCAGAGGCGCTGGGGCTGTG
gtggcgctgtttgcatgtctgagggatgtcccagggttgggaagagccaagtctgttccg
ttcctgctgcggggacttggcctcagctgcttctcttgcttctgcagggagccagagaga
ggctctgagaagaagaccagcggccccctttctcctcccacagggcctcctggcccggcg

 1.20 Intr +  24394  24544  151  1  1  133  109   107 0.999  18.65
tctgcgactacatgtacgcgggacctcgcccacggcccatgaggctcagggcgtcagagg
cgctggggctgtggtggcgctgtttgcatgtctgagggatgtcccagggttgggaagagc
caagtctgttccgttcctgctgcggggacttggcctcagctgcttctcttgcttctgcag
GGAGCCAGAGAGAGGCTCTGAGAAGAAGACCAGCGGCCCCCTTTCTCCTCCCACAGGGCC
TCCTGGCCCGGCGCCTGCAGGCCCCGCCGTGCGGCTGGGGTCCGTGCCCTACTCCCTGCT
CTTCCGCGTCCTGCTGCAGTGCTTGAAGCAG
gtgagtggggccgggcagggaccatccgtcccacgttgggccaggaggacagggagctgc
cacctgcctgctgggcctccctccctgtctggcctgtggagggcagccctccctcagagc
tgagccttcccccttccccgagcagctgcagggacagaggcctgcgctgggcaggctccc

 1.21 Intr +  24851  24973  123  1  0  114   36    79 0.987   7.26
ttcccccttccccgagcagctgcagggacagaggcctgcgctgggcaggctcccccggct
gagaacagggctccatagcccttgacgctgtgcagccacaaagcagagcctcagatgcta
gcttccgcctctgtctctagggtccagaaggccctgtcctgacgcctcctctcctcgcag
GAGTCTGACTGGAAGGTGCTGAAGCTGGTTCTGGGCAGGCTGCCTGAGTCCCTGCGCTAT
AAAGTGCTCATCTTTACTTCCCCTTGCAGTGTGGACCAGCTGTGCTCTGCTCTCTGCTCC
ATG
gtaccatggccggcctggggttggggtgggggacccagtagggtttttccccaaaagact
gcgagcctctgggcagagcgagtgagacccttcgggctcgggctccatttccctcaaact
cagctgcactctggagcgcagattgtgccttgggcagggtggagggacccctgccccagc

 1.22 Intr +  25384  25593  210  0  0   95   91   143 0.974  15.63
tgaatgtggatgtctcccatctgtgcttttcctaagtggggctcccgtgccgttcacctc
acattcctggtgtgttacttggcaggcactcccaccactccgaaagggaggcccttcctg
ggagggaggcaagaaggctccccagcccctttgccccctttcctgggcctgcgttcccag
GGCCTCCCCAGCCCCTCTGGCTACCCCGTGACCTGGCCGCTGGGGAGAGGTTTCATGCCT
GGATTTGGTCATCAGCTTTCAGGCCCAAAGACACTGGAGCGGCTCCGAGGCGCCCCAGAA
GGCTTCTCCAGAACTGACTTGCACCTGGCCGTGGTTCCAGTGCTGACAGCATTAATCTCT
TACCATAACTACCTGGACAAAACCAAACAG
gtaggaggtcagagcaggacaggcgagcttgatggggcctgggattcgagggcctggccc
aggtaggccccacatttttctcataaacgagtttctgccaggccagggatgagtgagttg
gctctgcttccctgggtggctgccagatgcccagagtggggacatccgattccctggtgc

 1.23 Intr +  26810  26999  190  1  1   91   81   328 0.753  32.77
agcagtctgctgtgcagagtctgctcgggtagctcagcactgctggctctgccccacagg
cattcagggacttgctaagcctcggctgttctcccggtggagcactcgaggttggcgagg
ggtaggcgaggctgcctctgctgcaagcgggtggggcctgaggtgtcctgtctcctgcag
CGCGAGATGGTCTACTGCCTGGAGCAGGGCCTCATCCACCGCTGTGCCAGCCAGTGCGTC
GTGGCCTTGTCCATCTGCAGCGTGGAGATGCCTGACATCATCATCAAGGCGCTGCCTGTT
CTGGTGGTGAAGCTCACGCACATCTCAGCCACAGCCAGCATGGCCGTCCCACTGCTGGAG
TTCCTGTCCA
gtgagtccccgccctgcctgcgcatgcacccgagaggttcgggctgtgtaacctgtgcgg
gcttctctggtgccctctctcaggactccttggggaacctgggtgtctcgccttctgctg
cctcagggcctgggcgtctctgcccggctgccatgagtgctctccttcctggctttgagg

 1.24 Intr +  28409  28502   94  0  1  118   89   130 0.848  16.28
gtggttggctggccatgggaccgagagttgaggccagggtcgggaaagccacgtccgtgt
ggccgtggccttctctcctctgcagcaccccatcgctgccgtgggcagagcagccgtgtt
ggccttcagaggcgctgcacgggaccccggctcccctgaccaccctctccattaccgcag
CTCTGGCCAGGCTGCCGCACCTCTACAGGAACTTTGCCGCGGAGCAGTATGCCAGTGTGT
TCGCCATCTCCCTGCCGTACACCAACCCCTCCAA
gtgagtggtcgccccaggccctgtgcctcccagccgtggcccccgctaggccttgcggca
gaaagccccggcagcctttgtccccaaggcctgagcgcctcggttttttgcacttcatgc
cctggggatgtttccctgctgccaggatggagtgccagcccccttctcatctcaggttta

 1.25 Intr +  28678  28780  103  1  1   71   86   116 0.789  11.04
tccaagtgagtggtcgccccaggccctgtgcctcccagccgtggcccccgctaggccttg
cggcagaaagccccggcagcctttgtccccaaggcctgagcgcctcggttttttgcactt
catgccctggggatgtttccctgctgccaggatggagtgccagcccccttctcatctcag
GTTTAATCAGTACATCGTGTGTCTGGCCCATCACGTCATAGCCATGTGGTTCATCAGGTG
CCGCCTGCCCTTCCGGAAGGATTTTGTCCCTTTCATCACTAAG
gtgggctcagggccggtgaaggctgtgtctctcggtaggccagggcttgctttgcccttg
gctgtccatggtcgggcagagtgacaggcaggtggagggcagtgggagggtgtttggggc
tgtgcctgtggcgctgggggctctgctgggcagcctgcagggctttgatgcgcggcaggc

 1.26 Intr +  29101  29210  110  0  2   69   37   183 0.534  11.55
ctctgctgggcagcctgcagggctttgatgcgcggcaggcattgaggggtgggagctggg
tgccgccgccttgcccctagcctgcagcttgtccctggccagggggcacccggcaggcct
ggtgagggcctccagcccccattgccacccctcactgtctgggtgtgctcactctgccag
GGCCTGCGGTCCAATGTCCTCTTGTCTTTTGATGACACCCCCGAGAAGGACAGCTTCAGG
GCCCGGAGTACTAGTCTCAACGAGAGACCCAAGAGGTACGGCCTGCGGGG
gtgtgcctggagtcggtgtggggtggggaaggacatggggctgtggcctgcctgacggtg
cctccaagtcagtgagtggaaatgggtcctgtgtgccctggagtatgtgaggcagggcag
gacctgcaagggccgctaacacccctcagcccctcagcaggttggccgtggtggcctggg

 1.27 Intr +  29669  29839  171  2  0   81   49   130 0.994   8.66
ggctgccccctcctctgcagcccccagcctgctgctagccggggactctgcttcatcacc
gccgccttgccggaccgcaaagagctgagccagcctctgtgttcttgtttgcatttcatt
tgaacggctttctcctcctgtcccccaccttcctgcccgagctattttggctttccctag
ATGGGAATACGGCATTTTCCAGCGTGACCTCAACTCGGAAGCTGTTGTCTCCAGCCCCTG
GGGGCCGGGGGCCAAGCTCGGCCATTACGGCCAGAGACTACTTTCTGGGGTCTTGGTCTC
TTTTCCTAGTGACCTTCAGGGCCTGGCCACTGAGGCCTCAGTGCCGCCTCG
gtcagagctgggcggtgcctgccttccgcgggtgggtgggattgcctggccagcacagcc
tggaatctgccgtgggggtgacccacacacgtttaatttgcactgacgttgtttgttttg
gtgtcatgcgtgaagccttacttgttctcagtcatgtttaccagacgtattatcatgcat

 1.28 Intr +  30208  30336  129  1  0   36   74   135 0.864   7.89
tctgtctcttccccgctaactgccctttggcatggctctttttgctcatctcacccgcgg
gatctctccatcctgaccctgtggcctgggacctttcctcctcacccctccactggcttg
ttctccccttcccgggagctgggctctctggggcgttggggctccttcctcacccgatag
TCTGAGGATAGCCAGACCCCCCAAACAAGGCTTGAATAACTCTCCACCCGTGAAAGAATT
CAAGGAGAGCTCTGCAGCCGAGGCCTTCCGGTGCCGCAGCATCAGTGTGTCTGAACATGT
GGTCCGCAG
gtagcgggactgtcgggtggggggcacggaccctggagcttggccccgtgagcacctggg
tggcagtgcatggggctgcttgcatgacctcatcgtctgcccgtgtcctccctggccagc
ccagggggagccggtgacgaggggtggaaaggttgcattctgtccccaggccccgtatga

 1.29 Intr +  31642  31806  165  1  0   91   27   259 0.511  20.37
tctgggacaatgtggtccacgtgattctcaagctgaggctcgctgggccgcccacgccct
gttggggtctttccgagcgaggtcctcagccgtgcatgcgttgagctttggcccttggtg
ataggtggctcggcccgccctacctggcaccctgaccctggtcacggcctctccctccag
CAGGATACAGACGTCCCTCACCAGTGCCAGCTTGGGGTCTGCAGATGAGAACTCCGTGGC
CCAGGCTGACGATAGCCTGAAAAACCTCCACCTGGAGCTCACGGAAACCTGTCTGGACAT
GATGGCTCGATACGTCTTCTCCAACTTCACGGCTGTCCCGAAGAG
gtccaggcggcactacagggctgggcgggcctgcgggagctccacgggcaagctgggttt
cacgctccctgtcttctaggtctcctgtgggcgagttcctcctagcgggtggcaggacca
aaacctggctggttgggaacaagcttgtcactgtgacgacaagcgtgggaaccgggaccc

 1.30 Intr +  31886  32038  153  2  0   89   47   107 0.991   7.08
gctgacgatagcctgaaaaacctccacctggagctcacggaaacctgtctggacatgatg
gctcgatacgtcttctccaacttcacggctgtcccgaagaggtccaggcggcactacagg
gctgggcgggcctgcgggagctccacgggcaagctgggtttcacgctccctgtcttctag
GTCTCCTGTGGGCGAGTTCCTCCTAGCGGGTGGCAGGACCAAAACCTGGCTGGTTGGGAA
CAAGCTTGTCACTGTGACGACAAGCGTGGGAACCGGGACCCGGTCGTTACTAGGCCTGGA
CTCGGGGGAGCTGCAGTCCGGCCCGGAGTCGAG
gtgactgcaccttcctttcctccgcgcctgccagcctcgacaccggctgtcccgagccca
ggcccacgtggcaccctcgtaccagcctggggactaagtccaccctgtgcgtgggattct
cttctcagctccagccccggggtgcatgtgagacagaccaaggaggcgccggccaagctg

 1.31 Intr +  32167  32279  113  1  2   77   88    76 0.991   7.69
ggtcgttactaggcctggactcgggggagctgcagtccggcccggagtcgaggtgactgc
accttcctttcctccgcgcctgccagcctcgacaccggctgtcccgagcccaggcccacg
tggcaccctcgtaccagcctggggactaagtccaccctgtgcgtgggattctcttctcag
CTCCAGCCCCGGGGTGCATGTGAGACAGACCAAGGAGGCGCCGGCCAAGCTGGAGTCCCA
GGCTGGGCAGCAGGTGTCCCGTGGGGCCCGGGATCGGGTCCGTTCCATGTCGG
gtgagccttggccccagccacctccacacaggcaccggggctccctcagttgctgctggt
cccagtgttcaggaaggccccgagcccaggggccggggtggctggcttcaggcccggccc
acgtcctgactctggggtgagccttccacagctcaccccagagccgtggagtggtggagt

 1.32 Intr +  32775  32987  213  1  0   83   84   277 0.999  26.71
ctgtggccctgggttcactgaggccagcactgtggtgggccgtgccccaagggcagagct
gccaccgtctctggctgcctgtggcactagcttgccaggctcggggggagcattcagctt
gaggctggtggttttgcatcaggtaagtggtggtcaccagtcctctgccctcttcttcag
GGGGCCATGGTCTTCGAGTTGGCGCCCTGGACGTGCCGGCCTCCCAGTTCCTGGGCAGTG
CCACTTCTCCAGGACCACGGACTGCACCAGCCGCGAAACCTGAGAAGGCCTCAGCTGGCA
CCCGGGTTCCTGTGCAGGAGAAGACGAACCTGGCGGCCTATGTGCCCCTGCTGACCCAGG
GCTGGGCGGAGATCCTGGTCCGGAGGCCCACAG
gtactgggcggggctggcctgagcgccatctttctgccagtcacccacagagctgtggac
actcaggggcgattgcagacttggccctcttgggatatttgggggtaacttttgtttttt
ttttgagacagagtcttgctctgtggcccacgctggaacgcagtggcgcaatctcggctc

 1.33 Intr +  34205  34408  204  0  0   84  109   354 0.999  37.49
tgagcggggcagcagggtgggtggccgtcagagcagcgctggctccgacatcgtggtcct
gaggattgtgggagggagcatgagggcaaaaccagggcccaggccaggaggcccctgggg
ggccagagatgggtaaggggaggtactggcctcaggccaaaggtgctgccgcctccgcag
GGAACACCAGCTGGCTGATGAGCCTGGAGAACCCGCTCAGCCCTTTCTCCTCGGACATCA
ACAACATGCCCCTGCAGGAGCTGTCTAACGCCCTCATGGCGGCTGAGCGCTTCAAGGAGC
ACCGGGACACAGCCCTGTACAAGTCACTGTCGGTGCCGGCAGCCAGCACGGCCAAACCCC
CTCCTCTGCCTCGCTCCAACACAG
gtgagtggcatggcgggccttggcacgggctctgctcccactggcctggtgctcccggtg
acggcaatgtggctcctctctgctgagggcgcccacacggctgggagtggtccctggcct
gcctcagcaccattgttctccggtgtttgggaggaggctgacccgtgggaggtgtctgcc

 1.34 Intr +  35046  35114   69  1  0   90   74    10 0.422   0.10
ggcactgccctcctcaggtctgcccaagcagcttgtagctagcactgggccccgtgcgcg
cccctgccggccgctggccctgccctctctcctctgcaggcacggggcctgtgctctctg
ctcgacctgtgtgtagcccctcctcctgctgacgtggccgcacacggccttcccttgcag
TGGCCTCTTTCTCCTCCCTGTACCAGTCCAGCTGCCAAGGACAGCTGCACAGGAGCGTTT
CCTGGGCAG
gtatcgcctctcagagggaagcggttggctgcagagcgccactctgcctcataggtgctg
tgctcgtcgcctcatccgcccacccccatggtccgtctgcctccattgccctggggagca
ggtcccgactcgcatgaggacgtctgtgcagaatgtctttggcttggccagcgggatccc

 1.35 Intr +  36305  36426  122  0  2   78   96   139 0.995  15.09
gtgcaggccttcccagcgtcctccctgcccgctcggtggatggcagcagtaagcagagcc
ctggggaggctcgcagggctgctgtccctctggtcaggagaaggctggttctcggaggcc
acgtcagggccagggcctggcccagccccacatccagcagccccgtctgtgtcctcccag
ACTCCGCCGTGGTCATGGAGGAGGGAAGTCCGGGCGAGGTTCCTGTGCTGGTGGAGCCCC
CAGGGTTGGAGGACGTTGAGGCAGCGCTAGGCATGGACAGGCGCACGGATGCCTACAGCA
GG
gtgagtgtggctcagagcctggaccctgctgacctcggggggctccttaggggaggcagg
gctctgcgtgggtgtgcctgcaccctgggaactggctctgaacttgggggagatgttctt
ccacatccctcgtgcacagacggtctgcactttgcagccatccacctgggccggccctgg

 1.36 Intr +  36658  36783  126  0  0   74   80    38 0.815   3.65
ggaggcagggctctgcgtgggtgtgcctgcaccctgggaactggctctgaacttggggga
gatgttcttccacatccctcgtgcacagacggtctgcactttgcagccatccacctgggc
cggccctggctgctgggcagcctgtggtctcaggggatgctgatacctctgctcacgcag
TGTGGGGCACAGCTGGTGGCAGTGCTGCTGCGTCAACGGGCGGGGGCCGTAGCCTGGTGC
TCGGGCTGGTCTGTGGCCCTGGGATGGAGGACAGATAGGGCCTCACCACCTCCAGGTCAA
CCCCAG
gtgggctcgagggtgcctgctgacaggggttctctttgggatggtcctttctagtcgtcc
tcagtctccagccaggaggagaagtcgctccacgcggaggagctggttggcaggggcatc
cccatcgagcgagtcgtctcctcggagggtggccggccctctgtggacctctccttccag

 1.37 Intr +  36838  37325  488  0  2   63   80   455 0.965  35.37
tgtggggcacagctggtggcagtgctgctgcgtcaacgggcgggggccgtagcctggtgc
tcgggctggtctgtggccctgggatggaggacagatagggcctcaccacctccaggtcaa
ccccaggtgggctcgagggtgcctgctgacaggggttctctttgggatggtcctttctag
TCGTCCTCAGTCTCCAGCCAGGAGGAGAAGTCGCTCCACGCGGAGGAGCTGGTTGGCAGG
GGCATCCCCATCGAGCGAGTCGTCTCCTCGGAGGGTGGCCGGCCCTCTGTGGACCTCTCC
TTCCAGCCCTCGCAGCCCCTGAGCAAGTCCAGCTCCTCTCCCGAGCTGCAGACTCTGCAG
GACATCCTCGGGGACCCTGGGGACAAGGCCGACGTGGGCCGGCTGAGCCCTGAGGTTAAG
GCCCGGTCACAGTCAGGGACCCTGGACGGGGAAAGTGCTGCCTGGTCGGCCTCGGGCGAA
GACAGTCGGGGCCAGCCCGAGGGTCCCTTGCCTTCCAGCTCCCCCCGCTCGCCCAGTGGC
CTCCGGCCCCGAGGTTACACCATCTCCGACTCGGCCCCATCACGCAGGGGCAAGAGAGTA
GAGAGGGACGCCTTAAAGAGCAGAGCCACAGCCTCCAATGCAGAGAAAGTGCCAGGCATC
AACCCCAG
gtgggcctcttgcttccgggcggggctcctgacacctctcctgcgggaacctggtgcctc
acttgccccaggccgagcgggctggggtggggtcctcgcctgtgccctagggctggctgg
aacccctgggagggcggtggagtgggagatggccaggctctgtgttcctccctgtgggct

 1.38 Intr +  37561  37636   76  1  1   79   80   101 0.709   9.07
gcctcacttgccccaggccgagcgggctggggtggggtcctcgcctgtgccctagggctg
gctggaacccctgggagggcggtggagtgggagatggccaggctctgtgttcctccctgt
gggctgtggctgccctggccaggccctcacctgggtgcccaccatcccctccctgtgcag
TTTCGTGTTCCTGCAGCTCTACCATTCCCCCTTCTTTGGCGACGAGTCAAACAAGCCAAT
CCTGCTGCCCAATGAG
gtaggcgtggcctccctctcctgcatccgctggagctgtgtggctcgggtgaatggtggg
gggcccagctctgctgctgggagctcaggcttgcagagggctctggcctaagctccctgt
ggcagcctgccgtgaccggcctgggtggggcggcctcctgtggacgggcgtctggggctc

 1.39 Intr +  37840  37932   93  0  0   45   94   165 0.835  14.12
catccgctggagctgtgtggctcgggtgaatggtggggggcccagctctgctgctgggag
ctcaggcttgcagagggctctggcctaagctccctgtggcagcctgccgtgaccggcctg
ggtggggcggcctcctgtggacgggcgtctggggctcaggcagggctctgtgtgccacag
TCACAGTCCTTTGAGCGGTCGGTGCAGCTCCTCGACCAGATCCCATCATACGACACCCAC
AAGATCGCCGTCCTGTATGTTGGAGAAGGCCAG
gtgaggctgcggggccggcctaggtgcctggacagggccagctgggcctcagcctgcagt
gggtagggagtctgggcccccaacgccccacagagctcaacactgccgggtcccctacag
catgaagtgctcattgagctctgtgccaggtgctgctctgagtgctggggaccccggtgc

 1.40 Intr +  38803  38989  187  0  1  143  102   404 0.999  47.77
agagagggagtcaaggatgacacccgatgtctggcctgggtggctgctggaatggatggt
cttgtctgcctcagggatcagagtggggctcccggcagagcctgctgggcacccccaccc
tctgcggggcagggcccggcccgggagtgatgccaccctgcctctcccctctccccacag
AGCAACAGCGAGCTCGCCATCCTGTCCAATGAGCATGGCTCCTACAGGTACACGGAGTTC
CTGACGGGCCTGGGCCGGCTCATCGAGCTGAAGGACTGCCAGCCGGACAAGGTGTACCTG
GGAGGCCTGGACGTGTGTGGTGAGGACGGCCAGTTCACCTACTGCTGGCACGATGACATC
ATGCAAG
gtacggcctggcgcctacccgctcctgctgccccaggcctcagggcacggctcccatcca
gtcctgctaccccacgccctggggcatggccctggcacccccacctgctccagctcccca
cgcctcaggttccgagcctaacagcgtgggcatggaggcagtgatggggctggtggcttt

 1.41 Intr +  39342  39481  140  1  2   79  113   362 0.985  39.17
gtggctttgcgtcccaaagccctgcccctggggagagccgaggaccactggccaggcacc
agaggacgtggtccccgcaggcccccagagcccctggagtaatcaggaggtgccccagtg
caaggcacagagggcctcagcactggccccacaaacccatccggccctgctcaccctcag
CCGTCTTCCACATCGCCACCCTGATGCCCACCAAGGACGTGGACAAGCACCGCTGCGACA
AGAAGCGCCACCTGGGCAACGACTTTGTGTCCATTGTCTACAATGACTCCGGTGAGGACT
TCAAGCTTGGCACCATCAAG
gtgagtgaggggccgtcagtgaggctgggccccaggcaggtgcccactgctgtgtcccgg
gttggtggcaggtcctcctccctgagcttcggtcacgaggagcaggaggagaggccgcag
tgctcagggccccgtgggcacgagcttcaccccgagcctgcgttgtgtcctctgtgccct

 1.42 Intr +  39844  39909   66  0  0   35   88    56 0.506   0.55
agcctgtggcgcctgctgctgagtgtctgtcaggagtaactggcaagtgcagactgggtg
tgctgggtgggcacagtgtagttggtgcttcctgtctgtccggcgcggcccttgggcccc
caccatctccccagtggcagctgtcaggctgctcagttggttatcgccacgcaccactag
GCAGCAACCAGCGTCACCCTCTTCCTGGAGGTGGGCTGGGTCGGCCAGTGTCACAGCACG
GTCCGG
gtgagccccagcatggcggggagagctggcatggcccaggcagggcagataggctggagg
cctcactccaagggccccaggatgctgaggcagccactgaaccaaaaccccggggctggt
agtcagagtccaggaggggcaggagcatagggaggtgggctctgctagatgccaagacaa

 1.43 Intr +  40473  40551   79  2  1  104   97   150 0.999  17.78
tggagggggcttggcctgggggaggccagacaaacacagccccgctgccagaggggaaag
ttcaggggcagatgctgcccatggagctgacaggtgtctagcagtgcaaccaggcagtag
ccgagatcagccttcagcacacgctgtgtgcggggatgaccctttctcttgtccgggcag
GGCCAGTTCAACTTTGTCCACGTGATCGTCACCCCGCTGGACTACGAGTGCAACCTGGTG
TCCCTGCAGTGCAGGAAAG
gtagggccgggtggggccctgcagtgcaggaaaggtagggccgggtggggccctgcagtg
tggcgccaagagccctgggcctggcgtgaccaccaagtctccccagacatggagggcctt
gtggacaccagcgtggccaagatcgtgtctgaccgcaacctgcccttcgtggcccgccag

 1.44 Intr +  40658  40749   92  0  2   -2   82   213 0.610  12.57
gttcaactttgtccacgtgatcgtcaccccgctggactacgagtgcaacctggtgtccct
gcagtgcaggaaaggtagggccgggtggggccctgcagtgcaggaaaggtagggccgggt
ggggccctgcagtgtggcgccaagagccctgggcctggcgtgaccaccaagtctccccag
ACATGGAGGGCCTTGTGGACACCAGCGTGGCCAAGATCGTGTCTGACCGCAACCTGCCCT
TCGTGGCCCGCCAGATGGCCCTGCACGCAAAT
gtgagtgggggtgggtccaggcgtgagctggtgggacaggcccaggtgccacctgatagt
gagctcaccccctgcctacgtccccagatggcctcacaggtgcatcatagccgctccaac
cccaccgatatctacccctccaagtggattgcccggctccgccacatcaagcggctccgc

 1.45 Intr +  40837  40992  156  0  0   93   65   124 0.616  12.00
gacatggagggccttgtggacaccagcgtggccaagatcgtgtctgaccgcaacctgccc
ttcgtggcccgccagatggccctgcacgcaaatgtgagtgggggtgggtccaggcgtgag
ctggtgggacaggcccaggtgccacctgatagtgagctcaccccctgcctacgtccccag
ATGGCCTCACAGGTGCATCATAGCCGCTCCAACCCCACCGATATCTACCCCTCCAAGTGG
ATTGCCCGGCTCCGCCACATCAAGCGGCTCCGCCAGCGGGTAGGGAATATGGGGCTCCCT
CAGCGGGGTGTGCTGGCTGCCCAAGCTGTGGGGCGG
gtgtgtgggcagagcggttgccacgcctcccagacttactgcccaagccgcctctgcctt
cagatctgcgaggaagccgcctactccaaccccagcctacctctggtgcaccctccgtcc
catagcaaagcccctgcacagactccagccgagcccacacctggctatgaggtgggccag

 1.46 Term +  41056  41220  165  0  0   85   54   259 0.935  21.07
gatatctacccctccaagtggattgcccggctccgccacatcaagcggctccgccagcgg
gtagggaatatggggctccctcagcggggtgtgctggctgcccaagctgtggggcgggtg
tgtgggcagagcggttgccacgcctcccagacttactgcccaagccgcctctgccttcag
ATCTGCGAGGAAGCCGCCTACTCCAACCCCAGCCTACCTCTGGTGCACCCTCCGTCCCAT
AGCAAAGCCCCTGCACAGACTCCAGCCGAGCCCACACCTGGCTATGAGGTGGGCCAGCGG
AAGCGCCTCATCTCCTCGGTGGAGGACTTCACCGAGTTTGTGTGA
ggccggggccctccctcctgcactggccttggacggtattgcctgtcagtgaaataaata
aagtcctgaccccagtgcacagacatagaggcacagattgcagtcagacagctcttttat
tgactttgtctgcttggtgcgggggttgggggggtgtcgaggctctagaagcggccatgc

Predicted peptide sequence(s):


>TSC2_1|GENSCAN_predicted_peptide_1|2137_aa
XLRLRVSILALKAVMPDSCGLHIPAAHAAPSRDARIAGLSARGRHRTTTPSKLPRRPSAQ
CRYRKCGSRFRRRPGARGVRLSPRRGGPERGGAAREGFSGASWSTMAKPTSKDSGLKEKF
KILLGLGTPRPNPRSAEGKQTEFIITAEILRELSMECGLNNRIRMIGQICEVAKTKKFEE
HAVEALWKAVADLLQPERPLEARHAVLALLKAIVQGQGERLGVLRALFFKVIKDYPSNED
LHERLEVFKALTDNGRHITYLEEELADFVLQWMDVGLSSEFLLVLVNLVKFNSCYLDEYI
ARMVQMICLLCVRTASSVDIEVSLQVLDAVVCYNCLPAESLPLFIVTLCRTINVKELCEP
CWKLMRNLLGTHLGHSAIYNMCHLMEDRAYMEDAPLLRGAVFFVGMALWGAHRLYSLRNS
PTSVLPSFYQGRWGDVVFVHSLQPNSGQLSVAAGLAHRVPRIQLLAMACPNEVVSYEIVL
SITRLIKKYRKELQVVAWDILLNIIERLLQQLQTLDSPELRTIVHDLLTTVEELCDQNEF
HGSQERYFELVERCADQRPESSLLNLISYRAQSIHPAKDGWIQNLQALMERFFRSESRGA
VRIKVLDVLSFVLLINRQFYEEELINSVVISQLSHIPEDKDHQVRKLATQLLVDLAEGCH
THHFNSLLDIIEKVMARSLSPPPELEERDVAAYSASLEDVKTAVLGLLVILQTKLYTLPA
SHATRVYEMLVSHIQLHYKHSYTLPIASSIRLQAFDFLLLLRADSLHRLGLPNKDGVVRF
SPYCVCDYMYAGPRPRPMRLRASEALGLWEPERGSEKKTSGPLSPPTGPPGPAPAGPAVR
LGSVPYSLLFRVLLQCLKQESDWKVLKLVLGRLPESLRYKVLIFTSPCSVDQLCSALCSM
GLPSPSGYPVTWPLGRGFMPGFGHQLSGPKTLERLRGAPEGFSRTDLHLAVVPVLTALIS
YHNYLDKTKQREMVYCLEQGLIHRCASQCVVALSICSVEMPDIIIKALPVLVVKLTHISA
TASMAVPLLEFLSTLARLPHLYRNFAAEQYASVFAISLPYTNPSKFNQYIVCLAHHVIAM
WFIRCRLPFRKDFVPFITKGLRSNVLLSFDDTPEKDSFRARSTSLNERPKRYGLRGWEYG
IFQRDLNSEAVVSSPWGPGAKLGHYGQRLLSGVLVSFPSDLQGLATEASVPPRLRIARPP
KQGLNNSPPVKEFKESSAAEAFRCRSISVSEHVVRSRIQTSLTSASLGSADENSVAQADD
SLKNLHLELTETCLDMMARYVFSNFTAVPKRSPVGEFLLAGGRTKTWLVGNKLVTVTTSV
GTGTRSLLGLDSGELQSGPESSSSPGVHVRQTKEAPAKLESQAGQQVSRGARDRVRSMSG
GHGLRVGALDVPASQFLGSATSPGPRTAPAAKPEKASAGTRVPVQEKTNLAAYVPLLTQG
WAEILVRRPTGNTSWLMSLENPLSPFSSDINNMPLQELSNALMAAERFKEHRDTALYKSL
SVPAASTAKPPPLPRSNTVASFSSLYQSSCQGQLHRSVSWADSAVVMEEGSPGEVPVLVE
PPGLEDVEAALGMDRRTDAYSRCGAQLVAVLLRQRAGAVAWCSGWSVALGWRTDRASPPP
GQPQSSSVSSQEEKSLHAEELVGRGIPIERVVSSEGGRPSVDLSFQPSQPLSKSSSSPEL
QTLQDILGDPGDKADVGRLSPEVKARSQSGTLDGESAAWSASGEDSRGQPEGPLPSSSPR
SPSGLRPRGYTISDSAPSRRGKRVERDALKSRATASNAEKVPGINPSFVFLQLYHSPFFG
DESNKPILLPNESQSFERSVQLLDQIPSYDTHKIAVLYVGEGQSNSELAILSNEHGSYRY
TEFLTGLGRLIELKDCQPDKVYLGGLDVCGEDGQFTYCWHDDIMQAVFHIATLMPTKDVD
KHRCDKKRHLGNDFVSIVYNDSGEDFKLGTIKAATSVTLFLEVGWVGQCHSTVRGQFNFV
HVIVTPLDYECNLVSLQCRKDMEGLVDTSVAKIVSDRNLPFVARQMALHANMASQVHHSR
SNPTDIYPSKWIARLRHIKRLRQRVGNMGLPQRGVLAAQAVGRICEEAAYSNPSLPLVHP
PSHSKAPAQTPAEPTPGYEVGQRKRLISSVEDFTEFV