GENSCAN 1.0	Date run: 15-Jan-104	Time: 10:52:20

Sequence TNFRSF17_1 : 5361 bp : 42.96% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   3681   3937  257  2  2   75   59   275 0.310  20.05
cccaggagtttgaatgcagcctgggcaacacagtaagaccccacctctaaaaaatgaaaa
aatctctctcacattgctttgagtcccgatgtgtactgctaagactctcatgaccacatt
ctctgtgaagtttgggttaatgtttccgtttctacataattaggatcaggtctcctgggc
ATGGCTAACATTGACCTGGAAAAGAGCAGGACTGGTGATGAAATTATTCTTCCGAGAGGC
CTCGAGTACACGGTGGAAGAATGCACCTGTGAAGACTGCATCAAGAGCAAACCGAAGGTC
GACTCTGACCATTGCTTTCCACTCCCAGCTATGGAGGAAGGCGCAACCATTCTTGTCACC
ACGAAAACGAATGACTATTGCAAGAGCCTGCCAGCTGCTTTGAGTGCTACGGAGATAGAG
AAATCAATTTCTGCTAG
gtaattaaccatttcgactcgagcagtgccactttaaaaatcttttgtcagaatagatga
tgtgtcagatctctttaggatgactgtatttttcagttgccgatacagctttttgtcctc
taactgtggaaactctttatgttagatatatttctctaggttactgttgggagcttaatg

Predicted peptide sequence(s):


>TNFRSF17_1|GENSCAN_predicted_peptide_1|86_aa
MANIDLEKSRTGDEIILPRGLEYTVEECTCEDCIKSKPKVDSDHCFPLPAMEEGATILVT
TKTNDYCKSLPAALSATEIEKSISAX