GENSCAN 1.0	Date run: 15-Jan-104	Time: 12:21:21

Sequence PPL_1 : 57017 bp : 53.61% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.02 Intr -    694    581  114  2  0   75   95    76 0.954   7.92
 1.01 Init -   1292    824  469  2  1   47   80   266 0.531  15.49
 1.00 Prom -   8277   8238   40                              -1.41

 2.01 Init +  15089  15121   33  1  0   66   75    28 0.200  -0.89
gaggccgggaagcatatctccccaactcttaggtctttgtatgatgcaaccagatcatcc
catcatccaaactaaaacttacctgtgctcccaaatgctctcagaaaagagagtgggtgg
ctgttgcattgggccaggtaagaagtggtgactttgatcaaggtgaggccagaggggcag
ATGGAGGAGGATGCGCAGGAGACGCGTTCCCAG
gtagaaccagtggagggagaagcagggacaggtctcagggatctgttggcataaccgggt
agacaggtcctccccaccctccccttctgcagtttcccttatgcggacggaagaacgttc
tcagagcagtgggaacaccctgtacccttcaaatccccaaacctactgactctgatcctt

 2.02 Intr +  15440  15595  156  1  0   55   53   127 0.380   6.62
cctgtacccttcaaatccccaaacctactgactctgatccttagcccaaacccaagacag
ctgaagcgggctgtgcgtttgtcccccagctaggcccagggagtgggcatctgggacgca
ggatctcctgtcctcccgacacctcattacccatatatgggcaccagcctctcctcgcag
ATGTTGGAGGAGATGGTTCCAAATTCTGAGGTTAGTTGTGAATTCCACGTGCCCCGGCAA
GGCAACATTCACAGGGCAGAAGCAAAGCACGTCTGGGCTTGCACCAGGATCAGCGTGAAC
AGTGTGGACGGCCGGGGGTCTGCTTTCATCTCCCAG
gtgctggaggattctaacttcaggccttggcttctggctttttgtttgtttctagggttt
ttttgttttgttttgttttgagatggagtcttgctctgtcacccaggctggagtgcagtg
gcacagtctcggctcactacaacctccgcctcccaggctcaagcgattctcctgtctcag

 2.03 Intr +  17224  17388  165  0  0   59   27   129 0.185   4.57
tctggtccctgggagtaccctcaaacacagccctggaactccgaggaggaaccgggcagc
ctcctgacctgctggttccatttttccttgcttgcatcaagagcctcatatgcagaccag
gccaagaaaatggggctctgtgagactgctcaggattgtcccagactctggcatccccag
CCCAGAAGGAAAAAGCTAGGGAAAAACAGCCTCAGTCGACTCGAGGTGACTCGTAGAGGC
TTGCAAAACCCATCTAGCAGGCAGCCCCTGACCCACAGCGTCAACAAGGCTGAGGGGGCT
GTTTCTGCTGCCAACCAAGTTCTGGGTCCTCATTCAGGCCCACTG
gtgaaacagccagcaaggcccgaattgtataaacaatgtaaatgagccaggcacagtggg
ctcatgcctgtaatccctgtactttaggaggccaagtcaggagcatcccttgagctcagg
agtttaagaccagcctgggcaacagagagagactccatgtctacaaaaaaattaaaaaat

 2.04 Intr +  22850  22982  133  1  1    9   49   222 0.495  11.12
ctagcatccccatgagtaacttctagcccagtcgatcacatgcctctggagtgagattgc
ttgcggggagaatcgcggttcaccagctgtgtgaccctgagcaagtgctttgatgtctca
gagtcttggtttcttcatccccttcttcaaaggggcacaccaacctccccggggacttag
GGCAAGGATGATATTGAGCTGGTGCCTGTGAATATGTCTGAGGTCTGGCAAAGCCCACAG
CAAGTGGCAAATGCCCAGGATGCCTTTGTGGTCATCGCCAGAGGACAGATGGAGAAGCGG
AGGCTGTACGAGG
gtagggcacttgcctgaggctgtctaagcagcaagcagcccagtgggccttgggcctggc
ctgtctgctcatagcttcctgctaccgctcacagctttgtcccatcaggagtccaaggtc
cctgaggcagtggtcattgccccacaactcccatgtcctctggggggcttcggctggaac

 2.05 Intr +  23077  23258  182  2  2   85   59    51 0.544   2.00
gcaaagcccacagcaagtggcaaatgcccaggatgcctttgtggtcatcgccagaggaca
gatggagaagcggaggctgtacgagggtagggcacttgcctgaggctgtctaagcagcaa
gcagcccagtgggccttgggcctggcctgtctgctcatagcttcctgctaccgctcacag
CTTTGTCCCATCAGGAGTCCAAGGTCCCTGAGGCAGTGGTCATTGCCCCACAACTCCCAT
GTCCTCTGGGGGGCTTCGGCTGGAACAACAGGCCCAGCCAGGATAGAGTCCAGAAGGTGG
CTTTTCTTGCATCTGCCACAATCCATGAAAGGGCTGGTTTGGGAGCTGGCCCTGTGCCTG
AG
gtgggactgggcccaagagagacaaaggcccccacttgagccacagtacagaccctaacg
atgcactgcagagtcaggggttaaatatttggggtgagactcaccgcctctaggtgcagc
tggcctggcagatggtcagtgactggggtgggagtgtgggggcccagaaactcacattct

 2.06 Intr +  24258  24328   71  2  2   60    4    52 0.131  -7.53
ggccccagaaccttgatctggggagcatcactcgaaagggctggtggtcccctctgcctt
gacggtcaagaaccccgccctggcccaccccacgggacgtgccaggacctgcctctctct
atggcgtgtcctcattggagccttctgcacaggaacaccaaattcttccttttgctttag
CACCCAGCCGACACCACCTCCTCCAGGAAGCCTTCAGTGACCACCGCTGTCCCCACCCAG
CCAGTCCAGAG
gttcccctgggcatccccagcctccaggcctgcctcagtctcgtgactgtttctataaat
actgatttcctcctggtctgtggggtggatcagggagggagaggcttgtctttgtgaggt
gcagggcccgcacacagcaggtgcttaatgagtgtgagtagaaggcaacttctgcgtgcc

 2.07 Intr +  27387  27486  100  0  1   90   65   295 0.866  28.01
cttgtctctgtggctttagtgatgttgccctatgggaacagcccaactacctcaaaggct
ctgtgggcagctcctgctcagagcgtggggccggggccagccagaggatggggtgctggt
ggggacatagcccccacccaccaggcaccccgcccatctcccctcggcttctgcccgcag
CATCTCTAACAAGGAGCTCTCGGAGCTGATCGAGCAGCTGCAGAAGAATGCCGACCAGGT
GGAGAAGAACATCGTGGACACAGAGGCCAAGATGCAGAGT
gtgagtgcccccactcccactcccacctgggtgccccgtgctgccagccctgttcaggac
caggatctgtttggaatcggtgattctcacccaggggtgattgtggccccgagggaacat
gcagagacattttggttgtcactgcttggaaggaaggtcctcctggcgtccagttgggga

 2.08 Intr +  34296  34450  155  2  2  100   33   309 0.875  25.98
accacgtagcagcaaagagatggaactaccgactgcgctccatatggacaagcctggaag
acgttattcaaagggaaagaaggggagcaccctgctgacccctttcctcccacccctccc
attgccaccgtgcccgctctcggctcctgttcattgtcccctctcttgtgaccctcacag
GACCTGGCTCGGCTGCAGGAGGGTCGGCAGCCTGAGCACCGGGACGTGACCCTGCAGAAG
GTGTTGGACTCTGAGAAGCTGCTCTATGTGCTAGAGGCGGATGCGGCCATTGCCAAGCAC
ATGAAGCACCCACAGGGGGACATGATCGCCGAGGA
gtaggtcccttctgcttcttaccccaggggagccattgggggctatgggccagggcgggg
ggtcctgttcagcatttgggagcccgagtcaggggttatcaagggctaattaggtgccag
gcacgtgccaaaggcttcacatgatcctttcttttttttttttttgagacgtagttttgc

 2.09 Intr +  35810  35930  121  2  1   59   60   236 0.680  18.90
aaaaaaaaaaaaaagtgcatgggaggaggggtgagaggatgctgtgattgtctggaaccc
aaggccatatggtcactgtgtccttccaggacactgaggccggggtctgggtggggggcc
cctcctggggtgcaggcagtgccaaccagccccactaagtgggagcctctctcccatcag
TATCCGCCAGCTGAAGGAGCGTGTGACCAACCTGCGCGGGAAACACAAGCAGATCTACAG
GCTGGCGGTGAAGGAAGTGGATCCACAGGTCAACTGGGCGGCACTGGTGGAGGAGAAGCT
G
gtatggcctggacggggccgctggctccagggtttcagctggggagggggctgtgcgtgt
gcagggagagcctacccatgtaatgggcatcccgggtcttaccagggagacagtcgtggt
cctgatggttttccagtgtgcccatgagaagagtgaggctcagagaagtgcagcacgaag

 2.10 Intr +  37247  37372  126  1  0   86   81   237 0.948  24.18
gtcagtgctcagcaaacagaacctcagggttgaaggtgtggccagcatctccttgtggct
ctgcagggccccgtgaaaaagagagcaccatcatgcccacccccgaggctcctggggtgg
ccacacgtccccagccctcagcccaccctctccttattgcttctctgccctcctggccag
GACAAGCTGAACAACCAGAGCTTTGGGACTGACCTGCCGCTGGTGGACCACCAAGTGGAG
GAGCATAACATCTTCCACAATGAGGTCAAGGCCATCGGGCCCCACCTGGCCAAGGACGGG
GACAAG
gtggggcgtgtgctggtgtggtggggacccagggatggagggggccgcgcctgcttcctg
gccctgacccatgccctcggctctgtcctcaggagcagaacagcgaactccgggccaagt
accagaaactgctggtgaggagctccctgggggaaaggcctcatggggagaggagaggat

 2.11 Intr +  37465  37506   42  0  0  120   81    52 0.989   6.62
gctggtggaccaccaagtggaggagcataacatcttccacaatgaggtcaaggccatcgg
gccccacctggccaaggacggggacaaggtggggcgtgtgctggtgtggtggggacccag
ggatggagggggccgcgcctgcttcctggccctgacccatgccctcggctctgtcctcag
GAGCAGAACAGCGAACTCCGGGCCAAGTACCAGAAACTGCTG
gtgaggagctccctgggggaaaggcctcatggggagaggagaggatgggaagcttggagt
cggggggacaaggatgtattgttttaaaaatgacataggcagctgggcatggtggctcac
gcctagcactttgggaggcagaggcaggaggatcacttgagcccacgagtttgagaccaa

 2.12 Intr +  38952  39113  162  2  0   87   90   346 0.998  35.39
caggtgacttgtctaagggggactggcctggacgtggctaagctgggcttgtcctcaggc
cacccatagctgggcttgtcctcaggccagccatagctgggccctgcaggaggtagggaa
ggaagcgagcagtggcagcgggctgaggacgcagccctttccttgccccggccccttcag
GCAGCATCACAGGCCCGGCAGCAGCACCTGAGTTCGCTGCAGGACTACATGCAGCGCTGC
ACCAATGAGCTGTACTGGCTGGACCAGCAGGCCAAGGGCCGCATGCAGTACGACTGGAGT
GACCGCAACCTCGACTACCCCAGCCGCCGGCGCCAGTATGAG
gtgggttctgggggcctggggcatcagggaggaggcagccctggaaggagcacgggaccg
ccaggctgggcactgaggcccctccactgccccccactgcagaatttcatcaaccggaac
ctggaggccaaagaggagagaatcaacaaactgcacagcgagggcgaccagctgctggcg

 2.13 Intr +  39216  39323  108  2  0   80   12   178 0.868  10.38
cagcaggccaagggccgcatgcagtacgactggagtgaccgcaacctcgactaccccagc
cgccggcgccagtatgaggtgggttctgggggcctggggcatcagggaggaggcagccct
ggaaggagcacgggaccgccaggctgggcactgaggcccctccactgccccccactgcag
AATTTCATCAACCGGAACCTGGAGGCCAAAGAGGAGAGAATCAACAAACTGCACAGCGAG
GGCGACCAGCTGCTGGCGGCCGAGCACCCCGGGAGGAACTCCATTGAG
gttcatgcaccccgagaccagacacctcccccagggtggcttctggttggccgctgcctg
tgggccgcctggagctcgggcagaccccggagctgggggtcctgcaagctgcatcttgtg
tctgtctgtctctttcttgctgtgtctgactctgcctcctccatttatcctgatccgttg

 2.14 Intr +  40566  40661   96  2  0  106   80   200 0.970  21.71
tgacccctctctcctcctcccactcctgagcagaagctggctacccctgtggtagccaca
cccagacagatgccagatgcctccctcccccgccatgccccagcccaatatcccagcagt
ccctcccttggtgtctgcagtacctgcccagtggtgaccggccccttctcttcctggcag
GCGCACATGGAGGCTGTGCACGCAGACTGGAAGGAGTACCTGAACCTGCTCATCTGCGAG
GAGAGCCACCTCAAGTACATGGAGGACTACCACCAG
gtacttacctttcctgggagtccccccagcaccgggggtgctactctctgagagcgctca
gtgcctacctggctcatgtgtggcctcgtgctccttggtccaggagccttgcggggcagc
catcccaggcccccagcacccatgcttctgatggcgtgtgcagacatgtcccaagcttgc

 2.15 Intr +  42620  42742  123  1  0   70   50   389 0.999  34.59
ctcagggagggtggggctgtctccacgcagaggagcctcaggctcagcacagggtcccat
gctggactccaggtgaaccggaggcccagccccgcctgagggatgagcttgaagcctccg
acagaagcccaggtgcttctagtggtttcctggctgtaacagagccaccttctcccctag
TTTCACGAAGACGTGAAGGACGCTCAGGAGCTGCTGCGCAAGGTGGACTCGGACCTGAAC
CAGAAGTATGGCCCTGACTTCAAGGACCGGTACCAGATTGAGCTGCTGCTGCGGGAGCTG
GAT
gtgagcgatggcccaggacccctgctggcccggggggcgggggacccctctacaccatgc
ctgccctcagccctgtacaggcccctccacagcaccccacctgctgaatccagcccctgc
tctgcgtcctcccaccagggggaaggctgttggtctcacctgggcccctgaccccgttct

 2.16 Intr +  42929  43075  147  1  0  111   96   271 0.995  31.14
gatggcccaggacccctgctggcccggggggcgggggacccctctacaccatgcctgccc
tcagccctgtacaggcccctccacagcaccccacctgctgaatccagcccctgctctgcg
tcctcccaccagggggaaggctgttggtctcacctgggcccctgaccccgttctctccag
GACCAGGAGAAGGTGCTGGACAAGTATGAGGACGTGGTGCAGGGGCTGCAGAAGCGAGGC
CAGCAGGTGGTGCCCCTCAAGTACCGCCGGGAGACTCCGCTCAAGCCCATCCCCGTGGAG
GCACTCTGTGACTTTGAGGGGGAGCAG
gtgcgtggggccagctcctctgttcacatcactacaaagtttttggggtaacatggttgg
atcccgggcctcaggcgccgttctcaggagcctgtgcctgtctccgtggttggtgtcact
ctgccaacccttcccctggtgcaggccaactggcacccctatgccgcccccacctcggct

 2.17 Intr +  43220  43435  216  1  0   82   37    67 0.487   0.23
cccgtggaggcactctgtgactttgagggggagcaggtgcgtggggccagctcctctgtt
cacatcactacaaagtttttggggtaacatggttggatcccgggcctcaggcgccgttct
caggagcctgtgcctgtctccgtggttggtgtcactctgccaacccttcccctggtgcag
GCCAACTGGCACCCCTATGCCGCCCCCACCTCGGCTGCCCTGGCCTTGTGTTCCACCAGC
TTAGCAACCCCAGTCCCTCCTCAGAAGTCCCAGGCCAGGTTCTCATTGGCTCACTGTGAG
TCACGTGTCCATCCTACACCAATCACTGTGGCCAGGGAATGCCAGGGTCCACCCTATACC
AATGACTGTGGCTGGCGAATGCCAGTCATTGGCCAG
gtccaagtcacatgtccatctggagcttgggaatggagaaggagagaccacagggactgg
gaattgggagggaaggttccccaaagggaaatggaggtgggttgctgggccggcagcctc
aacacatgtgcttctcctgcatgcccctccccactctacggggagggtccaagtgatgag

 2.18 Intr +  43718  43869  152  1  2   78   87   192 0.981  17.57
tgctgggccggcagcctcaacacatgtgcttctcctgcatgcccctccccactctacggg
gagggtccaagtgatgagccggggctccccaggtccaagagtcgggggctgagatggcaa
ccgggctcccaggccctcaggccctgccgggatcctgactgtccagcctgcccccgccag
GGCCTGATCTCGCGGGGCTACAGCTACACCCTGCAGAAGAACAACGGGGAGAGCTGGGAG
CTCATGGACAGCGCTGGGAACAAGCTGATTGCTCCGGCCGTGTGTTTTGTGATCCCCCCC
ACAGACCCTGAGGCCCTGGCTCTGGCTGACAG
gtacaagggcaaaggcgggagtctgcatggaccagtcccacccccagggcttctcaggcc
ccattcatagccccggggatttggactcagcctgtggggagcgcggggtcgctgacactc
tccatctgcacccccttggaagttcatgcaggagaggggcagattgtgggccagctgact

 2.19 Intr +  44698  44795   98  1  2   84   90   222 0.997  22.15
gaagagctctgagcccaggagcacagaaaggccagtgccacagtgagcacttgctgtccg
catctaaggagctgtcaggctcctctggggtgtctgcccagccagagtccgcagtcccgc
ctctgtgggtgcagggggtggtgggctgcccaggttcccagctcatttctgtcctcacag
CCTGGGCAGCCAGTACCGGAGCGTGCGGCAGAAGGCAGCTGGGAGCAAACGCACGCTGCA
GCAGCGGTATGAGGTGCTGAAGACCGAGAATCCCGGAG
gtgggtgccagggccactcgcctgaggctctgggggtaccggggaggaggggctggacca
gggtctgtgctgtggatgagacggcggggggctggctgcctaggtccatccctgggcctc
acacccctggcccgttgtcacacctgcctgtgtcctccctccctccacagatgcctctga

 2.20 Intr +  44966  45123  158  0  2  139   77   268 0.798  31.04
aatcccggaggtgggtgccagggccactcgcctgaggctctgggggtaccggggaggagg
ggctggaccagggtctgtgctgtggatgagacggcggggggctggctgcctaggtccatc
cctgggcctcacacccctggcccgttgtcacacctgcctgtgtcctccctccctccacag
ATGCCTCTGACCTACAGGGGCGGCAGCTGCTGGCTGGCTTGGACAAGGTGGCCAGCGACC
TGGACCGGCAGGAGAAGGCCATCACAGGGATCCTGCGGCCACCACTGGAGCAAGGCCGGG
CTGTGCAGGACAGTGCCGAGCGGGCCAAGGACCTCAAG
gtacctgcgggtcaggagcacaggtggggccgggggagccctgcactggccccctggggc
ccctatttgaggtcttttccccatggagtcttgggatattcactgcagctgtctgtcagg
gacagcctgctgcatgtaaaagggtcccaagtcatggaggtggcagggctgctgtcatta

 2.21 Intr +  46123  46301  179  0  2   69   31   332 0.785  24.83
cgtgaaaaatacagccctcaggctggggtccagatgccgggtcagagccccagaatgtgc
caggcctctccagctgcttccactgtgcctgatgtgggaatctgtgctcaccctgggcac
atcctcaggggaaggggctgcctggctgtgtccaaaactgaggggccctggttcccacag
AACATCACCAACGAGCTACTGCGGATTGAACCTGAGAAGACGCGGAGCACGGCTGAGGGC
GAAGCCTTCATCCAGGCCCTCCCAGGCAGTGGCACCACACCCCTGCTGAGGACCCGGGTG
GAGGACACCAACCGGAAATACGAGCACCTCCTGCAGCTGCTGGACTTGGCCCAGGAGAA
gtgggtggcagacaggcagcatggaggttggggtggggtcagggggccaggtgggcatcc
cccgacgcctgattggtgctctcagggttgatgtggccaaccgcctggagaagagcctgc
agcagagctgggagttgctggccacacacgagaaccatctgaatcaggatgacacagtgc

 2.22 Intr +  46387  46567  181  1  1   45   94   233 0.672  19.99
ggcagtggcaccacacccctgctgaggacccgggtggaggacaccaaccggaaatacgag
cacctcctgcagctgctggacttggcccaggagaagtgggtggcagacaggcagcatgga
ggttggggtggggtcagggggccaggtgggcatcccccgacgcctgattggtgctctcag
GGTTGATGTGGCCAACCGCCTGGAGAAGAGCCTGCAGCAGAGCTGGGAGTTGCTGGCCAC
ACACGAGAACCATCTGAATCAGGATGACACAGTGCCTGAGAGCAGCCGTGTCCTGGACAG
CAAGGGGCAGGAGCTGGCGGTGAGTCTAGGGCCCAAGTCCTGGGAGTCCTTCTCTGAGCA
G
gtgagagcatctggcacatccacccgcccgtctggatagatgaggacaccagcatccagt
ctccccaggtttggaatgcccaaattgggaactgcaaatggaggcccacagcacaaatcc
aagctattcacgggatctgtgtgacttacgggatttcgggtgccagcattttaagatcaa

 2.23 Intr +  47415  47608  194  2  2   89   94   321 0.977  31.61
aaaacagaagatggcagaagtgacccaggtttgggatgtacagagcaaggctccggtcct
tcctacctgtggccttgcccaccctcctacagtcagtggcccaggggcttcagtgggtgt
catcgcctggctctgggagctctggccgtagcaccgccgtctcctcctctgccccgccag
GCCATGGCCTGTGAGTTACAGGCCCAGAAGTCCCTCCTGGGTGAGGTGGAGCAGAACTTG
CAGGCGGCCAAGCAGTGCTCGAGCACACTGGCCAGCCGCTTCCAGGAGCACTGTCCGGAC
CTGGAGCGCCAGGAGGCCGAGGTGCACAAGCTGGGCCAGCGTTTCAACAACCTGCGCCAG
CAGGTGGAACGCAG
gtgagggtgcggtgggtggtggccatttttgttttctgagaatgcgatctaattccctct
aagcaatgctttagccgtgtcccacagattttgctgtttttctttttggtgagttcgtca
gattctctgacggccctgtggtctctcttttgagtcatgcttacctgggtcctgtaatcc

 2.24 Intr +  48002  48152  151  2  1   72  100   257 0.999  25.98
acccacctggttctccacagtccaacctgacgttccctaatgaccacccaccctgtgtgg
gagatacttggggtatttctggttgttacatttggttgtttcccactttaaaaaaaaaaa
tgagggctcggtgaggcatctgtttgctgtggctgaggcctgaacgctttgccttgacag
GGCGCAGAGCCTACAGAGCGCCAAGGCAGCCTACGAGCACTTCCACCGCGGCCATGACCA
CGTGCTGCAGTTCCTAGTCAGCATCCCCAGTTACGAGCCCCAGGAGACAGACAGCCTCAG
CCAGATGGAGACCAAGCTGAAGAACCAGAAG
gtgagatggccgtttccgcagccccaggcacacactggcaagggagggtcagaggtcaac
aagcccctttctggggagccaagcctttgggaggtggagcagggcagaggcctgccacag
ctgtgtcctccctgggcctcagctcaagctcccaacacccaaccctctgagaacaagaac

 2.25 Intr +  49275  49358   84  2  0   81  105    92 0.977  10.71
caacaacaacaaaaaaactgccttttgcaatgaataaaaatgtatacaagggagccattc
atcatactttgtgctagagaagaataaattcagattctgagatttccagctactgcatcc
atggttgcttttttaaattttttttctggttagttttgatttttaaactctgtcttacag
AACCTGCTAGATGAGATAGCAAGTAGGGAGCAGGAAGTACAGAAGATCTGTGCCAATTCC
CAGCAGTACCAGCAAGCTGTAAAG
gtgagccgggaaacttccgcccaaagcacaaacagcaggggtcttattccaccgtgccct
ggtcagagaagcagcaagcaccggccctggcacatgggggtggagctggccatccgaggc
actgccggctgctgtgcaaactggcacaggcttttgggaaaacagcatggtactagacat

 2.26 Intr +  50118  50234  117  2  0  108  105    43 0.976   9.17
gtaattctcaaaacctcctggaaatcactgcagggtgcagctgtgaggaagacccacgca
gattataaaaccagcacatggcacagggcaggtctgggtcagcctgaaggggtacaggaa
catgtctgtctcttctcagctgttttaatctcccctctgccatgtctctccctcatgcag
GACTATGAGTTAGAAGCAGAAAAACTAAGGTCTCTTCTCGACTTGGAGAATGGAAGGAGA
AGCCACGTGAGCAAGAGAGCCAGGCTCCAATCTCCTGCCACCAAAGTGAAGGAAGAG
gtgagttccatgggccaggcggcctcgggactgaggtggaggccaagctgccctgctccc
cagggagcatggtgtcacacgctggcctcagagatgcacacacaacagggaagccactga
gagccctcctgcatgcaaacaggtttggtaagagatgaggaacttgttctagggcagtga

 2.27 Intr +  51109  51201   93  0  0  136   93    88 0.991  14.76
atccatttttctctccaccggtgaggctacagtctaactccaggcaggagtgggcaagag
ctatgcctctacccccaaattccacacttctcaagaaccacgtccacgctgtctagctct
ctgttgcttaccctgttgacacctgtttgttgaccgctctcctaatcctcttctctgcag
GAAGCAGCACTTGCCGCCAAGTTCACTGAAGTTTATGCCATCAACAGACAGAGGCTGCAG
AATCTGGAGTTTGCTCTGAATCTCCTCAGACAG
gtaactgatcttagtaagaaattctacttcaggctgttctaacaggtgacaaatacagac
tctgtcttagagaaatggtttgtgaattgatggaagtgtccccttgctaacgtttctggg
cagggccaatgcaaagactggcccgagccaatgcttctactgacatgagaacttattcaa

 2.28 Term +  52289  54952 2664  1  0   96   48  4376 0.914 420.67
aaccccaaactagttgtttgatcctttttgaaagtaaccctagaactctacaactaacat
gaactggcactgagggagtcccttggggaccacaggacagccactctgaccaggtgggga
caggccctacatgtgctgccagagcctggctttaaccttgtcttgtcttctccatcacag
CAGCCGGAAGTAGAAGTGACCCATGAGACCCTGCAAAGGAATAGGCCGGACTCTGGAGTG
GAGGAGGCGTGGAAGATCAGGAAGGAACTGGATGAGGAGACTGAGCGGAGGCGGCAGCTG
GAGAACGAGGTCAAGAGCACCCAGGAAGAAATCTGGACCTTGAGGAATCAGGGGCCTCAG
GAATCGGTGGTGAGGAAGGAGGTGCTCAAGAAGGTGCCGGATCCCGTGCTGGAGGAGAGC
TTCCAGCAGCTGCAGCGGACGCTGGCAGAGGAGCAGCACAAGAACCAGCTGCTGCAGGAG
GAGCTGGAGGCACTGCAGCTGCAGCTGCGTGCCCTGGAGCAGGAGACCAGAGACGGGGGG
CAGGAGTACGTGGTCAAGGAGGTCCTGCGCATCGAGCCTGACAGGGCCCAGGCGGATGAG
GTCTTGCAGCTGCGGGAGGAGCTGGAGGCACTGAGGCGGCAGAAGGGCGCCCGGGAGGCA
GAGGTGCTCCTCCTGCAGCAGCGTGTGGCCGCCCTGGCTGAAGAGAAGAGCCGGGCGCAG
GAGAAGGTCACAGAGAAAGAGGTGGTGAAACTGCAGAATGACCCCCAGCTGGAGGCAGAG
TACCAGCAGCTGCAGGAGGACCACCAGCGCCAGGACCAGCTCAGGGAGAAGCAGGAGGAG
GAGCTGAGCTTCCTCCAGGACAAGCTCAAGAGGCTAGAGAAGGAGCGGGCCATGGCCGAG
GGCAAGATCACCGTCAAGGAGGTGCTCAAGGTGGAGAAGGACGCGGCCACCGAGAGGGAG
GTCAGCGATCTCACCCGCCAATATGAGGACGAGGCTGCCAAGGCTCGCGCTAGCCAGAGG
GAGAAGACGGAGCTGCTCCGAAAGATATGGGCCTTGGAGGAGGAGAACGCCAAAGTGGTG
GTGCAGGAGAAGGTGCGGGAGATCGTGCGGCCAGACCCCAAGGCGGAAAGTGAAGTGGCG
AACCTCCGCCTGGAGCTTGTGGAGCAGGAGCGAAAGTACCGGGGTGCCGAGGAGCAGCTC
CGGAGCTACCAGAGTGAGCTGGAGGCCCTCAGGAGGCGAGGCCCCCAGGTGGAAGTCAAA
GAGGTGACTAAGGAAGTCATTAAGTACAAGACTGACCCTGAGATGGAGAAGGAGCTTCAG
CGGCTCAGGGAGGAGATCGTGGACAAGACCAGACTGATCGAAAGGTGTGATTTAGAGATC
TACCAGCTGAAAAAGGAAATCCAGGCCCTGAAAGACACCAAACCCCAGGTCCAGACCAAA
GAGGTGGTCCAGGAGATCCTCCAATTCCAAGAAGACCCTCAAACCAAGGAGGAGGTGGCG
TCTCTGAGGGCAAAGCTCTCAGAGGAGCAGAAGAAACAAGTGGATCTGGAGAGGGAAAGA
GCTTCCCAGGAAGAGCAGATCGCCCGGAAAGAGGAGGAGCTCTCGCGGGTGAAGGAAAGG
GTGGTGCAGCAGGAGGTGGTCAGGTATGAGGAGGAGCCAGGCCTGCGGGCCGAGGCGAGC
GCCTTTGCCGAGAGCATCGATGTGGAGCTGCGGCAGATTGACAAGCTGCGGGCAGAGCTG
CGGCGGCTGCAGCGCCGGCGCACCGAGCTTGAGCGGCAGCTGGAGGAGCTAGAGCGCGAG
CGGCAGGCCCGCAGGGAGGCCGAGCGCGAGGTACAGCGGTTGCAGCAGCGGCTGGCAGCG
CTGGAGCAGGAAGAAGCTGAGGCCCGTGAGAAGGTAACCCATACGCAGAAGGTGGTGCTG
CAGCAGGACCCGCAGCAGGCGCGAGAGCATGCCCTGCTCCGACTCCAGCTGGAAGAAGAG
CAGCACCGGCGGCAGCTCCTGGAGGGGGAGCTCGAGACCCTCCGGAGGAAACTGGCTGCA
CTGGAGAAGGCGGAGGTCAAGGAGAAGGTGGTGCTCTCCGAGAGTGTCCAGGTGGAGAAG
GGCGACACCGAGCAAGAGATCCAGAGGCTCAAGAGCAGCCTGGAGGAGGAGAGCCGCAGC
AAGCGCGAGCTGGACGTCGAGGTGAGCCGGCTGGAAGCCAGGCTTTCGGAGCTGGAATTC
CATAACTCCAAGTCATCCAAGGAACTAGACTTTCTGAGGGAAGAGAACCACAAATTACAG
CTGGAGAGGCAAAACCTGCAGCTGGAGACCCGAAGGCTCCAATCGGAAATCAACATGGCA
GCGACGGAAACACGAGACCTGCGGAACATGACCGTGGCGGACTCTGGGACCAACCATGAC
TCCAGACTGTGGTCCCTGGAGAGGGAACTGGATGACCTCAAGAGGCTCTCCAAGGACAAA
GACCTCGAGATCGACGAGCTGCAGAAGCGCCTGGGCTCCGTGGCCGTCAAGCGGGAGCAG
CGGGAGAACCACCTGCGGCGCTCCATCGTAGTCATCCACCCTGACACAGGCCGCGAGCTG
TCCCCGGAGGAAGCCCACCGTGCCGGGCTCATTGACTGGAACATGTTCGTGAAACTCAGA
AGCCAGGAGTGCGACTGGGAGGAGATCTCAGTGAAGGGTCCCAATGGGGAGTCCTCAGTG
ATACACGACAGGAAGTCTGGCAAGAAGTTCTCCATCGAAGAGGCCCTGCAGAGTGGCAGG
CTGACCCCTGCTCAGTATGACCGCTATGTCAACAAGGATATGTCCATCCAGGAGCTGGCG
GTCTTGGTATCTGGGCAGAAGTAG
gcacagctcttgcaactcttcgtaacggcagacgctggccctctcctacgacgcagtgac
ctccttggtgtcgtcctctcccttgccctggtgcaggccaagcattttatacataccctc
gctgccaggctgctcagagtcccgcccacatatgagacaggcactggctgaagacaggca

Predicted peptide sequence(s):


>PPL_1|GENSCAN_predicted_peptide_1|195_aa
MVALGVRAAAAGGPGAHRGAGGSAGERAAARGARTAARQWLRVPTRWGRGARRPLALRAA
PREGGAYLPEEGPPRGRGLDAGVGTLGLGRTPPTPSRGTPEAGQALGRKGRRGERSQPHP
PRARRASGRGLHLVLRYRGTRRSWCFGGHPAGPRKTGWLTLLGKVFYCSQPQFTSLSNGD
NHHPIRKACGDVPAX

>PPL_1|GENSCAN_predicted_peptide_2|2068_aa
MEEDAQETRSQMLEEMVPNSEVSCEFHVPRQGNIHRAEAKHVWACTRISVNSVDGRGSAF
ISQPRRKKLGKNSLSRLEVTRRGLQNPSSRQPLTHSVNKAEGAVSAANQVLGPHSGPLGK
DDIELVPVNMSEVWQSPQQVANAQDAFVVIARGQMEKRRLYEALSHQESKVPEAVVIAPQ
LPCPLGGFGWNNRPSQDRVQKVAFLASATIHERAGLGAGPVPEHPADTTSSRKPSVTTAV
PTQPVQSISNKELSELIEQLQKNADQVEKNIVDTEAKMQSDLARLQEGRQPEHRDVTLQK
VLDSEKLLYVLEADAAIAKHMKHPQGDMIAEDIRQLKERVTNLRGKHKQIYRLAVKEVDP
QVNWAALVEEKLDKLNNQSFGTDLPLVDHQVEEHNIFHNEVKAIGPHLAKDGDKEQNSEL
RAKYQKLLAASQARQQHLSSLQDYMQRCTNELYWLDQQAKGRMQYDWSDRNLDYPSRRRQ
YENFINRNLEAKEERINKLHSEGDQLLAAEHPGRNSIEAHMEAVHADWKEYLNLLICEES
HLKYMEDYHQFHEDVKDAQELLRKVDSDLNQKYGPDFKDRYQIELLLRELDDQEKVLDKY
EDVVQGLQKRGQQVVPLKYRRETPLKPIPVEALCDFEGEQANWHPYAAPTSAALALCSTS
LATPVPPQKSQARFSLAHCESRVHPTPITVARECQGPPYTNDCGWRMPVIGQGLISRGYS
YTLQKNNGESWELMDSAGNKLIAPAVCFVIPPTDPEALALADSLGSQYRSVRQKAAGSKR
TLQQRYEVLKTENPGDASDLQGRQLLAGLDKVASDLDRQEKAITGILRPPLEQGRAVQDS
AERAKDLKNITNELLRIEPEKTRSTAEGEAFIQALPGSGTTPLLRTRVEDTNRKYEHLLQ
LLDLAQEKVDVANRLEKSLQQSWELLATHENHLNQDDTVPESSRVLDSKGQELAVSLGPK
SWESFSEQAMACELQAQKSLLGEVEQNLQAAKQCSSTLASRFQEHCPDLERQEAEVHKLG
QRFNNLRQQVERRAQSLQSAKAAYEHFHRGHDHVLQFLVSIPSYEPQETDSLSQMETKLK
NQKNLLDEIASREQEVQKICANSQQYQQAVKDYELEAEKLRSLLDLENGRRSHVSKRARL
QSPATKVKEEEAALAAKFTEVYAINRQRLQNLEFALNLLRQQPEVEVTHETLQRNRPDSG
VEEAWKIRKELDEETERRRQLENEVKSTQEEIWTLRNQGPQESVVRKEVLKKVPDPVLEE
SFQQLQRTLAEEQHKNQLLQEELEALQLQLRALEQETRDGGQEYVVKEVLRIEPDRAQAD
EVLQLREELEALRRQKGAREAEVLLLQQRVAALAEEKSRAQEKVTEKEVVKLQNDPQLEA
EYQQLQEDHQRQDQLREKQEEELSFLQDKLKRLEKERAMAEGKITVKEVLKVEKDAATER
EVSDLTRQYEDEAAKARASQREKTELLRKIWALEEENAKVVVQEKVREIVRPDPKAESEV
ANLRLELVEQERKYRGAEEQLRSYQSELEALRRRGPQVEVKEVTKEVIKYKTDPEMEKEL
QRLREEIVDKTRLIERCDLEIYQLKKEIQALKDTKPQVQTKEVVQEILQFQEDPQTKEEV
ASLRAKLSEEQKKQVDLERERASQEEQIARKEEELSRVKERVVQQEVVRYEEEPGLRAEA
SAFAESIDVELRQIDKLRAELRRLQRRRTELERQLEELERERQARREAEREVQRLQQRLA
ALEQEEAEAREKVTHTQKVVLQQDPQQAREHALLRLQLEEEQHRRQLLEGELETLRRKLA
ALEKAEVKEKVVLSESVQVEKGDTEQEIQRLKSSLEEESRSKRELDVEVSRLEARLSELE
FHNSKSSKELDFLREENHKLQLERQNLQLETRRLQSEINMAATETRDLRNMTVADSGTNH
DSRLWSLERELDDLKRLSKDKDLEIDELQKRLGSVAVKREQRENHLRRSIVVIHPDTGRE
LSPEEAHRAGLIDWNMFVKLRSQECDWEEISVKGPNGESSVIHDRKSGKKFSIEEALQSG
RLTPAQYDRYVNKDMSIQELAVLVSGQK