GENSCAN 1.0	Date run: 15-Jan-104	Time: 11:28:46

Sequence POLR2C_1 : 11736 bp : 48.13% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1259   1344   86  1  2   96   60   206 0.994  18.89
tacattttaaagcaggaggccgcagaagacgctcggcagttctggcctccgagcagcagg
cggcgctgtgagtcgtctttgcggaagccgcggaggcctcgctgactgacttccggtgtt
ggcggtggcgccgcgcagtcaccgcggagcagacgcggaggctggtggcccctgggcgag
ATGCCGTACGCCAACCAGCCTACCGTGCGGATCACGGAGCTCACTGACGAGAATGTCAAG
TTCATCATCGAGAACACCGACCTGGC
gtaaggctaccgagggaagaggctggcggctctggggcgccgggaggcccaagccggggc
cccggggcagggggcgggggtgtagtggggtggggtgggggcgatgtccttccagagctg
cccccctgcaccagggctttagctttgggagcctgcggcgcgggcccagcctgtcgaggc

 1.02 Intr +   1563   1612   50  0  2   91   87    51 0.989   3.62
gccgggaggcccaagccggggccccggggcagggggcgggggtgtagtggggtggggtgg
gggcgatgtccttccagagctgcccccctgcaccagggctttagctttgggagcctgcgg
cgcgggcccagcctgtcgaggctgcagcgccttcacgccccttggcttttgatctttcag
GGTGGCCAATTCGATTCGGAGGGTCTTCATCGCTGAGGTTCCCATAATAG
gtaagcgactccccttcctcgttcccgcgcccacgggttcctgccccgctctccacccac
acactctttggggctccttccagtccttggttcgggctgagggtggtagtgctgagaaaa
gtgcattgctggagacttgaccataccctgtgcccttggctcagtggccgcctccctggc

 1.03 Intr +   4487   4555   69  0  0   91   97    35 0.934   3.85
ggtgtggtgtgtgtgggtcttattaaaatgcaagtacctgggccccactctaatgctgtg
gaatcagcccagcaatctgcagtttagtgtcaggtgattcctaaatcttgagaaccactg
cattaagtctgtaggtaaatttgatggctaaactccatgtctgcttctttcattttttag
CCATTGACTGGGTTCAGATTGATGCCAATTCCTCAGTTCTTCATGATGAATTCATTGCTC
ACAGGCTTG
gtgagtactccttttactaggaggttaaagggagggtattgtgcctagtgtcaggagggg
gcctccttccagcctcacccccagaaggcttctgggttctcattttggcttggctgtttg
gttttctttaaagtgcttttctgttttttacaggattaattcccctcattagtgatgaca

 1.04 Intr +   4709   4761   53  0  2  110   79    92 0.937   9.13
atgatgaattcattgctcacaggcttggtgagtactccttttactaggaggttaaaggga
gggtattgtgcctagtgtcaggagggggcctccttccagcctcacccccagaaggcttct
gggttctcattttggcttggctgtttggttttctttaaagtgcttttctgttttttacag
GATTAATTCCCCTCATTAGTGATGACATTGTGGACAAGCTGCAGTACTCTCGG
gtatgttgtgtgattgggtggaatgtgaggtttggtggggaggctttggttctcaaaggg
atttttcctgacatttggcatccagcttgaatactgttgtagttctggaacaacaacgtg
gagatgttgtctagagcctgggcaggccttggtcctgcgttctgatggggcttcagattg

 1.05 Intr +   7699   7827  129  0  0  119   77   162 0.997  19.09
gtccatgagaatggtataccagattgtcacagcccacaagaacctggatactgatgaacc
cctttttacaggtgaagaaacttaaggaactgggcattagatgcaggaagccaagacaag
gagccaaggcaggagttgccatctccctttgactcattcctgcttcccttcctgccttag
GACTGCACATGTGAGGAGTTCTGCCCCGAGTGCTCGGTGGAGTTCACCCTCGATGTGCGG
TGCAATGAAGACCAGACGCGACATGTCACGTCTCGAGACCTCATCTCCAACAGCCCCCGG
GTCATTCCG
gtcagtgcgggagagcatcctcttttccctgggatcttttctcttctctggctggctcca
agtgggccagactggggttgatccttagaaaatgttggctttccctgttaccctctgcct
taatctgatccctagaagtgctaattctggattcctcttgggcatcgttagcatcgttgg

 1.06 Intr +   8244   8295   52  2  1   74  115   136 0.999  13.38
ctgaggctaccaccacaccctgaagtgggggttggagtcctgggggcatctgtgccacca
cctcgtcaggtgttcgttccctggttgacagattgcagtctagaggtgctgggatatgga
tgccagaggaggtgactggggaggtgagcagctaatgaatgcctggtggactccctacag
GTGACATCCCGGAACCGAGATAATGACCCCAATGACTACGTGGAGCAGGATG
gtaagtcttcctgacctgtcaccgtgtgggccagcgggaaggagggaccagacacagcct
ctcgtgctgcctggtctcctcgaaaattggctttagaccgtttttccagatgtgtgtggt
cttgcagtggcactccaagtcagaatttggagaagcatgtctctcctggcccttgactga

 1.07 Intr +   8495   8663  169  0  1  131   80   292 0.999  31.70
caccgtgtgggccagcgggaaggagggaccagacacagcctctcgtgctgcctggtctcc
tcgaaaattggctttagaccgtttttccagatgtgtgtggtcttgcagtggcactccaag
tcagaatttggagaagcatgtctctcctggcccttgactgacttgtgcctctccctgcag
ACATCCTCATCGTCAAGTTGAGAAAGGGCCAGGAGCTGAGACTTCGAGCCTATGCCAAAA
AGGGCTTTGGCAAGGAGCATGCCAAGTGGAACCCTACTGCAGGGGTGGCTTTTGAATACG
ATCCAGACAATGCCCTGAGGCACACAGTGTACCCCAAGCCCGAGGAATG
gtatgttccccttaggagtgatggcaggcatttggggtgggtgtggcatagaaatggctg
ttgttgactgagatgtggcaggctctctaggaacttgggtgccccaaaaggagcagtggc
aaccttgtgctgacctgtgtttgacctcaggccaaagagtgagtactcggagctggatga

 1.08 Intr +   8814   8888   75  0  0   76  116   179 0.999  18.13
gcacacagtgtaccccaagcccgaggaatggtatgttccccttaggagtgatggcaggca
tttggggtgggtgtggcatagaaatggctgttgttgactgagatgtggcaggctctctag
gaacttgggtgccccaaaaggagcagtggcaaccttgtgctgacctgtgtttgacctcag
GCCAAAGAGTGAGTACTCGGAGCTGGATGAGGATGAGTCGCAGGCTCCCTATGACCCCAA
CGGCAAGCCAGAAAG
gtaagagcctggttggacatgggaaggtgaagtgtggaagaagggatggttttggttcag
gccgtgagttaggcattccctctcccccacctcgcagttctcataagctgaggaggggct
gctgactgctaaactagacctgtggtatgtgcacatcccaggggcaggtcgtcagcccct

 1.09 Term +   9509   9653  145  2  1   75   36   116 0.980   2.48
aaagtgtgttgaaactaccctatgtaagaggttttacatgaaaggaagttagccctggcc
caaggtcaagttccatgtgggaacagagccaagacccggaaggaggaagggttgtccatg
gccagagctcgggtcggccagcctgcctcgcagtgcactcactggactcttgcctcctag
GTTTTACTACAATGTGGAGTCCTGTGGCTCTCTGCGTCCTGAAACCATTGTCCTGTCAGC
CCTCTCAGGATTGAAGAAGAAACTGAGTGATTTACAAACTCAATTAAGCCACGAGATCCA
GAGTGATGTGCTAACCATAAATTAA
ctgcagcttgcctgcttcagcaaaaacggagattcaggccagcagctggatatgggggtc
tctcttcagactcttctcgtttctgagaatctagtctactgttggttgagcttcttggca
ggacatcagtaccaactagaagtgggtcatagatagattaccagggatgcagtggtgttt

Predicted peptide sequence(s):


>POLR2C_1|GENSCAN_predicted_peptide_1|275_aa
MPYANQPTVRITELTDENVKFIIENTDLAVANSIRRVFIAEVPIIAIDWVQIDANSSVLH
DEFIAHRLGLIPLISDDIVDKLQYSRDCTCEEFCPECSVEFTLDVRCNEDQTRHVTSRDL
ISNSPRVIPVTSRNRDNDPNDYVEQDDILIVKLRKGQELRLRAYAKKGFGKEHAKWNPTA
GVAFEYDPDNALRHTVYPKPEEWPKSEYSELDEDESQAPYDPNGKPERFYYNVESCGSLR
PETIVLSALSGLKKKLSDLQTQLSHEIQSDVLTIN