GENSCAN 1.0	Date run: 15-Jan-104	Time: 13:01:56

Sequence MSLN_1 : 10169 bp : 66.96% C+G : Isochore 4 (57 - 100 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   2786   2870   85  1  1   92   82   130 0.892  11.89
gacagagggctcagtggctggagggcagggccagggtgcggacacaagctgcaggtacca
cagaagtttgctctgggagcccctcctgggcccatgtggccccaggctggcccaggacag
aggcgtggggtgggagcagggggtcccatcctgagtcactgccctccacagacacagacc
ATGGCCTTGCCAACGGCTCGACCCCTGTTGGGGTCCTGTGGGACCCCCGCCCTCGGCAGC
CTCCTGTTCCTGCTCTTCAGCCTCG
gtgcgtacttgatggggctgctggtgaggtggggacggcccaggggccttgggggccagg
cccccagcaaggctttgcctgcccctgccttctccctggagtgcctgtggtggccacgtc
tcagcagcagtctctgcccccagaggtgactggagctggagatccagccagggagtgatg

 1.02 Intr +   3338   3381   44  0  2  130  110    17 0.919   7.19
cccctgtgcctgggggactgtgatgtcacggggtacatgggcctgagccactggcttctc
tttggggtgtgcacagggctggctgtgggggcggccaggctctgcctccttcctcccctg
ggtcagggcacagcccagaggcccgccccctcccccaagctgtcccctctgcccctttag
GATGGGTGCAGCCCTCGAGGACCCTGGCTGGAGAGACAGGGCAG
gtaaggtcccctctggggaaacaggggagggtcttcaggtcccaggtgggggtgccatgc
tgtgttctctctgtcacgtatccacggtgcttgccagtttccacggtccttgcttgcaaa
ggggcacctggacctgcatgtgactggcctgggagcagccaggtccagggagcggcagag

 1.03 Intr +   4168   4248   81  0  0   27   82   137 0.433   7.99
cgtcacctggtcttggggggaggtctgcagggagcaccagggtcctttggggagaggtgg
ggctgtggggcttggggagcactgggtggacattgcaggggaggggcgatcgtgggtgcc
cagcccgacccttcctgcagcctctcccctcgccaactccttggcttcccgtgtgcggag
GTGTCCGGCCTGAGCACGGAGCGTGTCCGGGAGCTGGCTGTGGCCTTGGCACAGAAGAAT
GTCAAGCTCTCAACAGAGCAG
gtcagtctcagttgggctgaggcaggtgggcacagctggggctgaggaattcacaggcag
ctctgcagtgcccaccttgccaccacggtcccctctgtccctgctgccatctctccccgg
ccagttcttcccagagttcctctggccacccaagctgaccactggggtgcctgtccacgt

 1.04 Intr +   4752   4831   80  2  2  102   32    82 0.912   3.50
agccaggcacgggagcccccatcccccagggcagcgctgcaggcggccagagatccactt
ccacagattctcgtggccagggcaggggtgtgttgtggtgggcagactggccaggcgacc
ctggcccaccatgtgagtggcggctcgaaacgctctgtgctggactccctgcccctgcag
CTGCGCTGTCTGGCTCACCGGCTCTCTGAGCCCCCCGAGGACCTGGACGCCCTCCCATTG
GACCTGCTGCTATTCCTCAA
gtaggccctgccccctgaacccacccccccggcttttgccgccagccctcagcccccaac
cccctgccccttgcctcggatcccaggccacagcagagatgtggaggccggccgggctgc
ctctcagggtggggacgggtgtgatcagtgcggcctgtccccagcaccctctcttcacag

 1.05 Intr +   5012   5141  130  2  1   93   45   157 0.989  13.77
gtaggccctgccccctgaacccacccccccggcttttgccgccagccctcagcccccaac
cccctgccccttgcctcggatcccaggccacagcagagatgtggaggccggccgggctgc
ctctcagggtggggacgggtgtgatcagtgcggcctgtccccagcaccctctcttcacag
CCCAGATGCGTTCTCGGGGCCCCAGGCCTGCACCCGTTTCTTCTCCCGCATCACGAAGGC
CAATGTGGACCTGCTCCCGAGGGGGGCTCCCGAGCGACAGCGGCTGCTGCCTGCGGCTCT
GGCCTGCTGG
gtaggggctggggccagcgcggggcggagagggctcggcagttccaaaagcgctgaggcc
agcctctctgcagggtgtgcgggggtctctgctgagcgaggctgatgtgcgggctctggg
aggcctggcttgcgacctgcctgggcgctttgtggccgagtcggccgaagtgctgctacc

 1.06 Intr +   5146   5408  263  0  2   49  114   118 0.573   8.03
acgggtgtgatcagtgcggcctgtccccagcaccctctcttcacagcccagatgcgttct
cggggccccaggcctgcacccgtttcttctcccgcatcacgaaggccaatgtggacctgc
tcccgaggggggctcccgagcgacagcggctgctgcctgcggctctggcctgctgggtag
GGGCTGGGGCCAGCGCGGGGCGGAGAGGGCTCGGCAGTTCCAAAAGCGCTGAGGCCAGCC
TCTCTGCAGGGTGTGCGGGGGTCTCTGCTGAGCGAGGCTGATGTGCGGGCTCTGGGAGGC
CTGGCTTGCGACCTGCCTGGGCGCTTTGTGGCCGAGTCGGCCGAAGTGCTGCTACCCCGG
CTGGTGAGCTGCCCGGGACCCCTGGACCAGGACCAGCAGGAGGCAGCCAGGGCGGCTCTG
CAGGGCGGGGGACCCCCCTACGG
gtaagtgaaggtgtctggaacctcgaaggctcacctggcggcgtggtatcagcagcgtga
ggacacttgcggccatgcctcaaggcccagggtcagtcacccccgccaccacccctgcca
atgcccccagcgtcccctccacagccagggggtacggcctggcctcttccctctctgggg

 1.07 Intr +   5539   5722  184  1  1   76   94   133 0.612  13.70
cagcaggaggcagccagggcggctctgcagggcgggggacccccctacgggtaagtgaag
gtgtctggaacctcgaaggctcacctggcggcgtggtatcagcagcgtgaggacacttgc
ggccatgcctcaaggcccagggtcagtcacccccgccaccacccctgccaatgcccccag
CGTCCCCTCCACAGCCAGGGGGTACGGCCTGGCCTCTTCCCTCTCTGGGGCTGCACGTGG
GGGGTCCCTGAGCTGTGTCCCGTGTCTGCACAGCCCCCCGTCGACATGGTCTGTCTCCAC
GATGGACGCTCTGCGGGGCCTGCTGCCCGTGCTGGGCCAGCCCATCATCCGCAGCATCCC
GCAG
gtgagaccccaatccccagcccgtggggatgcccggccacccgaggctcagcccaggtcc
tgctcgtcctcagggcatcgtggccgcgtggcggcaacgctcctctcgggacccatcctg
gcggcagcctgaacggaccatcctccggccgcggttccggcgggaagtggagagtgagtg

 1.08 Intr +   5796   5895  100  2  1   89   70   161 0.998  15.25
tcccgtgtctgcacagccccccgtcgacatggtctgtctccacgatggacgctctgcggg
gcctgctgcccgtgctgggccagcccatcatccgcagcatcccgcaggtgagaccccaat
ccccagcccgtggggatgcccggccacccgaggctcagcccaggtcctgctcgtcctcag
GGCATCGTGGCCGCGTGGCGGCAACGCTCCTCTCGGGACCCATCCTGGCGGCAGCCTGAA
CGGACCATCCTCCGGCCGCGGTTCCGGCGGGAAGTGGAGA
gtgagtgccgtgccctgcgcagtctggcaccaggctgggcagcacccctgggggtgggca
tcactttagggtctcacctgcccctccctggctctgcagcacatcccattataatcacag
agagtggacagaatccctgtttgccagtgggtaaactgaggcacagggagggtcacaaat

 1.09 Intr +   6164   6342  179  0  2  120   53   396 0.971  40.14
tggctctgcagcacatcccattataatcacagagagtggacagaatccctgtttgccagt
gggtaaactgaggcacagggagggtcacaaatggcccgaggtctcatctcacaggaggtg
tgggaggaagaaggggtcaaacgaactccggccctgacccctgacccctgtgccctgcag
AGACAGCCTGTCCTTCAGGCAAGAAGGCCCGCGAGATAGACGAGAGCCTCATCTTCTACA
AGAAGTGGGAGCTGGAAGCCTGCGTGGATGCGGCCCTGCTGGCCACCCAGATGGACCGCG
TGAACGCCATCCCCTTCACCTACGAGCAGCTGGACGTCCTAAAGCATAAACTGGATGAG
gtagttcatgactcaagttcccaccggcctgctgtgtccaagccatccccagcccctctg
ggagtgacatgggccctcctggtctcttggcctgcagctctacccacaaggttaccccga
gtctgtgatccagcacctgggctacctcttcctcaagatgagccctgaggacattcgcaa

 1.10 Intr +   6440   6595  156  1  0   83   60   218 0.996  19.90
tgctggccacccagatggaccgcgtgaacgccatccccttcacctacgagcagctggacg
tcctaaagcataaactggatgaggtagttcatgactcaagttcccaccggcctgctgtgt
ccaagccatccccagcccctctgggagtgacatgggccctcctggtctcttggcctgcag
CTCTACCCACAAGGTTACCCCGAGTCTGTGATCCAGCACCTGGGCTACCTCTTCCTCAAG
ATGAGCCCTGAGGACATTCGCAAGTGGAATGTGACGTCCCTGGAGACCCTGAAGGCTTTG
CTTGAAGTCAACAAAGGGCACGAAATGAGTCCTCAG
gtgaccgtccggctcgggggtcatgtggcatgagattgggaagggctgaggggcagagtg
ggggacaaagcctgaggttgggcgggcctggggtcaggggcacggcctgaggttatgctg
gtggtggagggatacatctctccttgccacaaggctcctcggcggcccctcccacaggtg

 1.11 Intr +   6773   6915  143  1  2   91  105   197 0.998  22.04
caggtgaccgtccggctcgggggtcatgtggcatgagattgggaagggctgaggggcaga
gtgggggacaaagcctgaggttgggcgggcctggggtcaggggcacggcctgaggttatg
ctggtggtggagggatacatctctccttgccacaaggctcctcggcggcccctcccacag
GTGGCCACCCTGATCGACCGCTTTGTGAAGGGAAGGGGCCAGCTAGACAAAGACACCCTA
GACACCCTGACCGCCTTCTACCCTGGGTACCTGTGCTCCCTCAGCCCCGAGGAGCTGAGC
TCCGTGCCCCCCAGCAGCATCTG
gtgagtccccagaactctgcccggcaaggtgggtccgtgtgctggcgctcactgtccacc
caccgtgtccccagggcggtcaggccccaggacctggacacgtgtgacccaaggcagctg
gacgtcctctatcccaaggcccgccttgctttccagaacatgaacgggtccgaatacttc

 1.12 Intr +   6990   7117  128  0  2  106   80   212 0.999  23.70
gccagctagacaaagacaccctagacaccctgaccgccttctaccctgggtacctgtgct
ccctcagccccgaggagctgagctccgtgccccccagcagcatctggtgagtccccagaa
ctctgcccggcaaggtgggtccgtgtgctggcgctcactgtccacccaccgtgtccccag
GGCGGTCAGGCCCCAGGACCTGGACACGTGTGACCCAAGGCAGCTGGACGTCCTCTATCC
CAAGGCCCGCCTTGCTTTCCAGAACATGAACGGGTCCGAATACTTCGTGAAGATCCAGTC
CTTCCTGG
gtgagccagggagtccctggccagggtgggcaacacaacgggggaagcacagactccact
cgggggtgccaggcctttgcctcgccgggccgtctgctgccagggtaactgggtggtcac
ccgccctctgccccccggggtgtgtatggccttaggggctgtgggttctgaccccagctc

 1.13 Intr +   7481   7575   95  0  2   73   60   168 0.995  13.34
gcgccagccacctccagggtctcccacgcctgggggtcaggcggctaggcaaacccaggc
cctggaatccctaaggaaaaagggaagccctgtaaggcaagtgggcttcctgcagcctgt
ggtcaagggcctgggggtgtgaggtgaggcctcagctcgggcccctctcccggcgggcag
GTGGGGCCCCCACGGAGGATTTGAAGGCGCTCAGTCAGCAGAATGTGAGCATGGACTTGG
CCACGTTCATGAAGCTGCGGACGGATGCGGTGCTG
gtatggcgagcgggaggaggggcgtgtggaggaggggcccgtggaggaggggcgagtggg
aggaggggcgcgtggagggggggcgtgtgggggggtgcgtggaggaggggcgcgtggagg
aggggcgcgtggaggggggagcgtggggggcgtggaggaggggcgcgtggaggaggggcg

 1.14 Intr +   8484   8670  187  2  1   45   86   374 0.996  33.37
tggggcctagggaagggcagccattgagctgaggtcagctggccggagacctccgaagtc
tggagaggctgcggtgggcatctgtgggtggggcagtttggacacaggagagcctggcag
ccctctggcggcgctgagggaaggagaccctccttgatggctgcccggggtctctggcag
CCGTTGACTGTGGCTGAGGTGCAGAAACTTCTGGGACCCCACGTGGAGGGCCTGAAGGCG
GAGGAGCGGCACCGCCCGGTGCGGGACTGGATCCTACGGCAGCGGCAGGACGACCTGGAC
ACGCTGGGGCTGGGGCTACAGGGCGGCATCCCCAACGGCTACCTGGTCCTAGACCTCAGC
ATGCAAG
gtgggcggggcggccaggccagggctgggggcagagctgggggcgtggaggtgggcgctc
tgagtcacccctctctctgtagaggccctctcggggacgccctgcctcctaggacctgga
cctgttctcaccgtcctggcactgctcctagcctccaccctggcctgagggccccactcc

Predicted peptide sequence(s):


>MSLN_1|GENSCAN_predicted_peptide_1|619_aa
MALPTARPLLGSCGTPALGSLLFLLFSLGWVQPSRTLAGETGQVSGLSTERVRELAVALA
QKNVKLSTEQLRCLAHRLSEPPEDLDALPLDLLLFLNPDAFSGPQACTRFFSRITKANVD
LLPRGAPERQRLLPAALACWGLGPARGGEGSAVPKALRPASLQGVRGSLLSEADVRALGG
LACDLPGRFVAESAEVLLPRLVSCPGPLDQDQQEAARAALQGGGPPYGVPSTARGYGLAS
SLSGAARGGSLSCVPCLHSPPSTWSVSTMDALRGLLPVLGQPIIRSIPQGIVAAWRQRSS
RDPSWRQPERTILRPRFRREVEKTACPSGKKAREIDESLIFYKKWELEACVDAALLATQM
DRVNAIPFTYEQLDVLKHKLDELYPQGYPESVIQHLGYLFLKMSPEDIRKWNVTSLETLK
ALLEVNKGHEMSPQVATLIDRFVKGRGQLDKDTLDTLTAFYPGYLCSLSPEELSSVPPSS
IWAVRPQDLDTCDPRQLDVLYPKARLAFQNMNGSEYFVKIQSFLGGAPTEDLKALSQQNV
SMDLATFMKLRTDAVLPLTVAEVQKLLGPHVEGLKAEERHRPVRDWILRQRQDDLDTLGL
GLQGGIPNGYLVLDLSMQX