GENSCAN 1.0	Date run: 15-Jan-104	Time: 12:40:38

Sequence KCNG4_1 : 19933 bp : 51.88% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1224   1281   58  2  1   68  113    21 0.144   4.08
cccccagggctctcctgcagctgctggagagagagatgcagaatgaatgaacttctggtt
tctggaggaggcacgggaagaaagattggaaactgactctgctagaaactgctgttttgg
ggatttttttcttccccttcatctccaccagaaacctgtcccttccctgggcaccaagag
ATGGGCTCCCCTTGCCTGGCAGAGAAACAGCTGGAAACTGGCTCCCTGAGACAAGAAG
gtgagttaaactggaggggaagagttactgcttgctgtagggtgggcgggggccaggggg
aagttgacgctgttagacatccttggcaaaagtgctggtttgagtgaattcctttcccgt
gctccagaaggagctgtttgccagctgtttggagagccgtagatggcaaaattgggttta

 1.02 Intr +   3464   4221  758  0  2   67   99  1137 0.079 104.53
actaaaggttaaaagaacaagccatgcagatgcagtcacaggaaagcacacgtaagaaca
tctgcagtcgtgacatccaggactctttgccccaagactgatttcccttccttttgcttg
ctctttgtcccttgggtgtcagactggtaaacccagcgcttcctacctggtggtcttcag
CAATGCCCATGCCTTCCAGAGACGGGGGCCTGCATCCCAGACACCACCACTATGGTTCCC
ACAGCCCTTGGAGTCAGCTCCTGTCCAGCCCCATGGAGACGCCGTCCATCAAGGGCCTTT
ACTACCGGAGGGTGCGGAAGGTGGGTGCCCTGGACGCCTCCCCAGTGGACCTGAAGAAGG
AGATCCTGATCAACGTGGGGGGCAGGAGGTATCTCCTCCCCTGGAGCACACTGGACCGGT
TCCCGCTGAGCCGCCTGAGCAAACTCAGGCTCTGTCGGAGCTACGAGGAGATCGTGCAGC
TCTGCGATGATTACGACGAGGACAGCCAGGAGTTCTTCTTCGACAGGAGCCCCAGCGCCT
TCGGGGTGATCGTGAGCTTCCTGGCGGCCGGGAAGCTGGTGCTTCTGCAGGAGATGTGCG
CGCTGTCCTTCCAGGAGGAGCTGGCCTACTGGGGCATCGAGGAGGCCCACCTGGAGAGGT
GCTGCCTGCGGAAGCTGCTGAGGAAGCTGGAGGAGCTGGAGGAGCTGGCCAAGCTGCACA
GGGAGGACGTACTGAGGCAGCAGAGGGAGACCCGCCGCCCCGCCTCGCACTCCTCGCGCT
GGGGCCTGTGCATGAACCGGCTGCGCGAGATGGTGGAAAACCCGCAGTCCGGGCTGCCCG
GGAAGGTCTTCGCTTGCCTCTCCATCCTCTTCGTGGCCACCACAGCCGTCAGCCTGTGTG
TCAGCACCATGCCCGACCTCAGGGCAGAGGAGGACCAG
gtgagcggcctctgatggcattcacggctccatcccgcagggtgcctgggcggagatgtc
ttttaggggcccaagaaaatgtcttcagatcttaaaataagaagaaaaaaatgaatatta
tccaacatgggttatattcattattaggccatcagtcataaaagataattttccatcttt

 1.03 Intr +   9974  10201  228  1  0  102   80    60 0.278   5.19
atatcaggggccagcacagagtggacgcttgttgttctgctcccccttggggctgggctc
acacccctggacctgctctgctgctctgctcaccagcctccatccctggctccctccaac
ctaatagcaatggccaagtcaggggccggtggctcaaatgtcctctccatccccttccag
TGTCTGCCCTCATTCCTCCTCTGCTCCGGCTGTCAGCGCGTCTTTTCTGAGAGCCTGCTC
TGGCTGGAGACCCGGTGGGAGAAGCAGGCGAACTCGCCACGCGCAGGACCAGCCCTGCCG
GCCTTCCCACTGTTCTCCTCCCATCTTGGGTGCTACGCCTGCCCCACAGCATTGCCTGGG
GCTTTCAGGGATATTGTCAGAGGGACATGCACACCCTATGGCAACCAA
gtaaggtgcccttggtgatgtctctgcagaaccatggtgggcttagggagcagaactgca
cgggctctttggtcctcgccttccctctcatcctggactgtagacatttcagtgtcttac
taaggtggagggcaggggaaggaaggcacagagagagttttctttgtttgtttattttga

 1.04 Term +  17931  18734  804  2  0  150   35  1346 0.999 129.19
agtctctgacctagccgatctgctgtgtacccagccacaactggaaaactgtgtaaaagg
aggttctggtggacgactaagtttacagcacaaagctcatgggcatgaagtcgtcccccg
atttccagcacagttgcaagtccactctctaccccgcgttgttgcctcttctccccgcag
GGCGAATGCTCTCGGAAGTGCTACTATATTTTCATCGTGGAGACCATCTGCGTGGCCTGG
TTCTCCCTGGAGTTCTGCCTGCGGTTTGTCCAGGCCCAAGACAAGTGTCAGTTCTTCCAG
GGGCCCCTGAACATCATCGACATCCTGGCCATCTCCCCATACTACGTGTCGCTGGCGGTG
TCTGAGGAGCCCCCGGAGGACGGCGAGAGGCCGAGCGGGAGCTCCTACCTGGAGAAGGTG
GGGCTGGTCCTGCGTGTGCTGCGAGCGCTGCGCATCCTCTACGTGATGCGCCTGGCTCGC
CACTCGCTGGGGCTGCAGACGCTGGGGCTCACCGTGCGCCGTTGCACACGTGAGTTCGGC
CTGCTCCTTCTCTTCCTGGCCGTGGCCATCACCCTCTTCTCCCCTTTGGTCTACGTGGCC
GAGAAGGAGTCCGGGCGGGTGCTGGAGTTCACCAGCATCCCCGCCTCCTATTGGTGGGCC
ATCATCTCCATGACAACGGTGGGCTACGGGGACATGGTGCCCCGCAGTGTGCCAGGCCAG
ATGGTGGCCCTCAGCAGCATCCTGAGCGGGATCCTCATCATGGCCTTCCCGGCCACGTCT
ATCTTCCACACCTTCTCCCACTCCTACCTGGAGCTCAAGAAGGAGCAGGAGCAGCTTCAG
GCCCGCCTCCGCCACCTCCAAAACACCGGTCCAGCCAGTGAATGTGAACTCCTGGACCCC
CATGTGGCCAGTGAACATGAGCTCATGAACGATGTCAATGACCTAATCCTGGAGGGCCCA
GCCTTGCCTATCATGCACATGTAA
ctcagcaccccccatgactacatggtaacctcaacccatcaccctgcctgaaacacactc
aagggtaccccgcatagaccacctggtggtgtttctagagcccagggaagactttcaaag
ctggaggggcataaggccacagaggctgtgtgtctgtgatccttgtccctcggggccccg

Predicted peptide sequence(s):


>KCNG4_1|GENSCAN_predicted_peptide_1|615_aa
MGSPCLAEKQLETGSLRQEAMPMPSRDGGLHPRHHHYGSHSPWSQLLSSPMETPSIKGLY
YRRVRKVGALDASPVDLKKEILINVGGRRYLLPWSTLDRFPLSRLSKLRLCRSYEEIVQL
CDDYDEDSQEFFFDRSPSAFGVIVSFLAAGKLVLLQEMCALSFQEELAYWGIEEAHLERC
CLRKLLRKLEELEELAKLHREDVLRQQRETRRPASHSSRWGLCMNRLREMVENPQSGLPG
KVFACLSILFVATTAVSLCVSTMPDLRAEEDQCLPSFLLCSGCQRVFSESLLWLETRWEK
QANSPRAGPALPAFPLFSSHLGCYACPTALPGAFRDIVRGTCTPYGNQGECSRKCYYIFI
VETICVAWFSLEFCLRFVQAQDKCQFFQGPLNIIDILAISPYYVSLAVSEEPPEDGERPS
GSSYLEKVGLVLRVLRALRILYVMRLARHSLGLQTLGLTVRRCTREFGLLLLFLAVAITL
FSPLVYVAEKESGRVLEFTSIPASYWWAIISMTTVGYGDMVPRSVPGQMVALSSILSGIL
IMAFPATSIFHTFSHSYLELKKEQEQLQARLRHLQNTGPASECELLDPHVASEHELMNDV
NDLILEGPALPIMHM