GENSCAN 1.0	Date run: 15-Jan-104	Time: 11:58:17

Sequence HPR_1 : 5591 bp : 47.17% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +   1203   1288   86  0  2  113   82    49 0.982   6.26
tggtcctagcacttccatatattgattttcttttctggctgcttagtgggaggagtgtgt
gtgtatgcatgtgtgtgtgtgcgtgtgtgtgtgtgtgtacatgcctgtgtgtgtggatgc
atgcatgtgctgtgaagcagggagaccagctttccgctccttcttgttttctctctgcag
TGACCTGGGAGCTGTCATTTCCCTCCTGCTCTGGGGACGACAGCTTTTTGCACTGTACTC
AGGCAATGATGTCACGGATATTTCAG
gtcagtctttgagttgggtaggagcatgcatccctggcactgccacatcccactctgact
ctctcgggtctgcattctttctttgagaacacacagttccccattcttatcctgacctct
gggctttcaggactgccaagaacattggggatcctgccagaaatgaggggagcttgagct

 1.02 Intr +   1595   1696  102  0  0  146   95   193 0.999  25.95
tcaggactgccaagaacattggggatcctgccagaaatgaggggagcttgagctttcgtt
ggcttctatttggggtagaaggagattgatgtgcagagcagcttccactcatctgacttt
tcatgggtctctgggaacaatttccaaatggtaaactctctggcttctctctctttgcag
ATGACCGCTTCCCGAAGCCCCCTGAGATTGCAAATGGCTATGTGGAGCACTTGTTTCGCT
ACCAGTGTAAGAACTACTACAGACTGCGCACAGAAGGAGATG
gtaagacctggacaactatctctgtgctctacctacaacccctgctctgacatttccatg
atgggtggtgctgaggtgatttgccagaaagttcgttgctctccttggagccaggagatt
tagattctgataagcgttttgtcgccagtagccatggccctttgggcagactaacttttg

 1.03 Intr +   2456   2530   75  0  0   98   94    81 0.990   9.19
acttggcttccagcacagcactctttcccttcctccttctcgtattctctctcctttctc
ccttcctgtctgcctcctttcttcttcttctttttaattcttctccttaaatgccttctc
actctgctctgggtgcagacttgacttttcctttggctcatttcttgccttttgtttcag
GAGTATACACCTTAAATGATAAGAAGCAGTGGATAAATAAGGCTGTTGGAGATAAACTTC
CTGAATGTGAAGCAG
gtgggtgctgagcactgagcacttaagagagcaggcaggcgtccagcggggaacgtccta
gaggcacagccttccagtgcggcttcctctgagcacacaagagccaggaggagggatgtg
ggagaaccgcagctggccagggagagacttaagcagttaggtgatgactccctaaggatc

 1.04 Term +   3614   4392  779  0  2   77   38   707 0.973  58.13
aattaaaaaaattattttaaaactgcaactattggaaatgagatcagcaggtggtaagga
caaagcatttaaatctttccagtttatgcagcagtgacagccgccaatgctttcacccct
ttctcagatggaaaggctcttgcacatttccactcacgagtgtcttgctctccttgacag
TATGTGGGAAGCCCAAGAATCCGGCAAACCCAGTGCAGCGGATCCTGGGTGGACACCTGG
ATGCCAAAGGCAGCTTTCCCTGGCAGGCTAAGATGGTTTCCCACCATAATCTCACCACAG
GGGCCACGCTGATCAATGAACAATGGCTGCTGACCACGGCTAAAAATCTCTTCCTGAACC
ATTCAGAAAATGCAACAGCGAAAGACATTGCCCCTACTTTAACACTCTATGTGGGGAAAA
AGCAGCTTGTAGAGATTGAGAAGGTGGTTCTACACCCTAACTACCACCAGGTAGATATTG
GGCTCATCAAACTCAAACAGAAGGTGCTTGTTAATGAGAGAGTGATGCCCATCTGCCTAC
CTTCAAAGAATTATGCAGAAGTAGGGCGTGTGGGTTACGTGTCTGGCTGGGGACAAAGTG
ACAACTTTAAACTTACTGACCATCTGAAGTATGTCATGCTGCCTGTGGCTGACCAATACG
ATTGCATAACGCATTATGAAGGCAGCACATGCCCCAAATGGAAGGCACCGAAGAGCCCTG
TAGGGGTGCAGCCCATACTGAACGAACACACCTTCTGTGTCGGCATGTCTAAGTACCAGG
AAGACACCTGCTATGGCGATGCGGGCAGTGCCTTTGCCGTTCACGACCTGGAGGAGGACA
CCTGGTACGCGGCTGGGATCCTAAGCTTTGATAAGAGCTGTGCTGTGGCTGAGTATGGTG
TGTATGTGAAGGTGACTTCCATCCAGCACTGGGTTCAGAAGACCATAGCTGAGAACTAA
tgcaaggctggccggaagcccttgcctgaaagcaagatttcagcctggaagagggcaaag
tggacgggagtggacaggagtggatgcgataagatgtggtttgaagctgatgggtgccag
ccctgcattgctgagtcaatcaataaagagctttcttttgacccatttctgtgttgtgtt

Predicted peptide sequence(s):


>HPR_1|GENSCAN_predicted_peptide_1|347_aa
XDLGAVISLLLWGRQLFALYSGNDVTDISDDRFPKPPEIANGYVEHLFRYQCKNYYRLRT
EGDGVYTLNDKKQWINKAVGDKLPECEAVCGKPKNPANPVQRILGGHLDAKGSFPWQAKM
VSHHNLTTGATLINEQWLLTTAKNLFLNHSENATAKDIAPTLTLYVGKKQLVEIEKVVLH
PNYHQVDIGLIKLKQKVLVNERVMPICLPSKNYAEVGRVGYVSGWGQSDNFKLTDHLKYV
MLPVADQYDCITHYEGSTCPKWKAPKSPVGVQPILNEHTFCVGMSKYQEDTCYGDAGSAF
AVHDLEEDTWYAAGILSFDKSCAVAEYGVYVKVTSIQHWVQKTIAEN