GENSCAN 1.0	Date run: 15-Jan-104	Time: 13:06:50

Sequence GFER_1 : 5837 bp : 60.32% C+G : Isochore 4 (57 - 100 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1111   1368  258  0  0  120   56   293 0.864  26.63
cgcctccacacgggcccgcaagcaggcaccgcccccgactctgcccccagccccggctcg
ggcccggcccccgcgagcacggcgcgcgcctccggctcctgtggccgcgcgctggcctgg
aggctgacctggaggctcatctggaggccgagctgacccggcaggccttgcgcgggcaac
ATGGCGGCGCCCGGCGAGCGGGGCCGCTTCCACGGCGGGAACCTCTTCTTCCTGCCGGGG
GGCGCGCGCTCCGAGATGATGGACGACCTGGCGACCGACGCGCGGGGCCGGGGCGCGGGG
CGGAGAGACGCGGCCGCCTCGGCCTCGACGCCAGCCCAGGCGCCGACCTCCGATTCTCCT
GTCGCCGAGGACGCCTCCCGGAGGCGGCCGTGCCGGGCCTGCGTCGACTTCAAGACGTGG
ATGCGGACGCAGCAGAAG
gtgcagttccctgcccgatttctcccagccccgcgcagcccctgtccccgcccccgccca
ggtaccccggcagagcttcccagggttgcctgtccctgaaccttgccccccgggtaggcc
cggccttacagccttcatccgcgcgtgggttggatcgtctgcaggactttggccggagtc

 1.02 Intr +   1639   1835  197  0  2   84  116   154 0.571  17.22
tgtccctgaaccttgccccccgggtaggcccggccttacagccttcatccgcgcgtgggt
tggatcgtctgcaggactttggccggagtccagtgggccaccggctgggccgtacagtgg
ggagctttgggcgcctttgttcggagaatgaactcactctcggtcggcctgcttccgcag
CGGGACACCAAGTTTAGGGAGGACTGCCCGCCGGATCGCGAGGAACTGGGCCGCCACAGC
TGGGCTGTCCTCCACACCCTGGCCGCCTACTACCCCGACCTGCCCACCCCAGAACAGCAG
CAAGACATGGCCCAGTTCATACATTTATTTTCTAAGTTTTACCCCTGTGAGGAGTGTGCT
GAAGACCTAAGAAAAAG
gtaagatgtgtttgcacgcagcagagctttgcactggagcctgggcctggggctcctggc
tgacgttatagcggggaacgtagagaaacggatgcagaggtggcagaagtttgctgagga
gcagggacctccaacaggtgaggactggggctatctgagcctcctcctctcgtctcagaa

 1.03 Term +   2758   2920  163  1  1  101   44   216 0.965  16.86
acccggggagctgcagggtcagccctgttctgggagtgcctgtaccttggagcataaggg
cactcccaggtgtagttcacagcagtgccccagctctccttccttgacagcagacaggga
actggcaggggcagtggagccgctgcgtcctctcattctttacctgctctccctacacag
GCTGTGCAGGAACCACCCAGACACCCGCACCCGGGCATGCTTCACACAGTGGCTGTGCCA
CCTGCACAATGAAGTGAACCGCAAGCTGGGCAAGCCTGACTTCGACTGCTCAAAAGTGGA
TGAGCGCTGGCGCGACGGCTGGAAGGATGGCTCCTGTGACTAG
agggtggtcagccagagctcatgggacagctagccaggcatggttggataggggcagggc
actcattaaagtgcatcacagccagagcctgttgtgtctcagttgggtggtccccaggac
actgcctgtggggacctgccctgcccctcttaggtttggagcagaagtggaggtgcccac

Predicted peptide sequence(s):


>GFER_1|GENSCAN_predicted_peptide_1|205_aa
MAAPGERGRFHGGNLFFLPGGARSEMMDDLATDARGRGAGRRDAAASASTPAQAPTSDSP
VAEDASRRRPCRACVDFKTWMRTQQKRDTKFREDCPPDREELGRHSWAVLHTLAAYYPDL
PTPEQQQDMAQFIHLFSKFYPCEECAEDLRKRLCRNHPDTRTRACFTQWLCHLHNEVNRK
LGKPDFDCSKVDERWRDGWKDGSCD