GENSCAN 1.0	Date run: 15-Jan-104	Time: 12:41:34

Sequence COTL1_1 : 54863 bp : 50.46% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1350   1426   77  2  2  103   62   216 0.677  21.06
cgcgctctccgtccgcagtggaagccgccgccgcgctcgcagcttgcaggcgccgcgtag
ccgtcgccaccgccgccagcccgtgcgccctcggcgcgtacccgccgcgctcccatcccc
gccgccggccaggggcgcgctcggccgccccggacagtgtcccgctgcggctccgcggcg
ATGGCCACCAAGATCGACAAAGAGGCTTGCCGGGCGGCGTACAACCTGGTGCGCGACGAC
GGCTCGGCCGTCATCTG
gtaggaacttttcattcgtctccacgccccgctccccgggctcgcgcggggcctcgtgca
ccgagccggcctccaggcgggacggattcgggcctcccgcgctgtcttcctcgccttatt
ccgggacggcgtgccaggcccccgcgggcttctccgtggccagcgcgtctgttagattgt

 1.02 Intr +   1681   1763   83  1  2   50   91   123 0.946   8.08
aggcgggacggattcgggcctcccgcgctgtcttcctcgccttattccgggacggcgtgc
caggcccccgcgggcttctccgtggccagcgcgtctgttagattgtcctctgcaagcgcc
gcgtcgcgcggccaccagcgctgatgtgtgtgtgtgtttttttcttctcccaacccaaag
GGTGACTTTTAAATATGACGGCTCCACCATCGTCCCCGGCGAGCAGGGAGCGGAGTACCA
GCACTTCATCCAGCAGTGCACAG
gtagggaggcgcgcctgccgggcggatgcgcggtcgttgggaggttgtctgcacccgggg
agccccggccagagcgaacccgggaggaaccggtggccacatggggtgcccctggcgcat
ggcgtgggaggaacccggtgtgagcgttttaaggcctcataaaaccttctcccctctgga

 1.03 Intr +   2652   2691   40  1  1   66   21    66 0.437  -5.02
tgtatacttaagatttgtgtgccttaggcacttccctgtggcttgtgaaccatgaaaaga
aagaccacgtggcaggcatcgccataaacccttcggtagtggcagaggctctgtgatgtt
ggtaatgggaccttttaaagagattggagaatgcgactccctcccatctctggtctttag
TTGGAAGCAAGCTTTCGGACAACGGCAGCACAGCCCGGAG
gttacggcgtggaccctgagccagacggtgtgggttacttatttatttatttatttattt
atttatttttgagacagaatcttcctcttttgcccaggctggagtgcagtggtacaatct
cagctaactgcaacctccgtctcccgggttcaagagattctcctgcctcagcctcctgag

 1.04 Intr +   4162   4256   95  1  2   48   79   107 0.555   5.41
aaaaatgcttccctgctgtgtgtggatcctcatgaatgggccatgggagcttcagctgca
gtgctttctttccccagccatctgttggacaaatgcataggagaattatggttgccgtgt
ctgctcttgttcctctcggaaacgcttgttccttcctgtcgtcgtgtcctcataacccag
GGACAATGGACTCAACACTGGCACTGGCTGGATAGCAGTCACCACGCTCGACGTGCCTTA
TCTTGGTCATACCTCAGAACAGCCTGGTGTGGCAG
gtactaaggttactcctattctacagatgaggaaacggaggcccagagaggttaataggc
ttcctgcattcacccagctagaaagtggcagagttgggacttgaacccaggcaggctggc
tcggggcaggtgctcttggcttctgaggaggttgtttagattctcacctctcgtgggatt

 1.05 Intr +   5043   5107   65  1  2  105   75    44 0.097   3.24
tttccagagggccacggggtgtctgtgctgccaggccagttccctcccacccccgcactc
atcctcccaatctttctgcctgctctgggtctgcgctgcttcttcccgagcttgcctggc
tcccggccttcctcgctgcctgcccctccgctacctccgctcttgcttcttgctccatag
CTCAGTTCGCCTGGGATGGTCAGAGACCTTGCGAGGGCGGTGAGAAATGCCCAGTGCAGA
TTAAT
gtaagcagaaaatccactgtggcctctagcctggaaactccaggggaagtcctagcagca
gcaaagactgcccgaactccaaacagcctctcctcctcctcctagctctgtcttcatcct
tcacctccattcttgcggggaggggggaggtttagcccctgggcagagccatcttggtgg

 1.06 Intr +  10883  10917   35  1  2   43  119    11 0.083  -3.28
cactatccagtctcccattgccttctttgcccacagatctgttgctgggaggccctgagc
cacgctgcatagcttttttgtgtgtccacaggggcgtgggctttgtggtagctctttcag
tctactgcatggtgatgtttgtgctttcttttctgtttgtggctgtgtcaccacaaacag
AAAATGATGAAGGATGATAGATGTGTATCTTCCTG
gtaagtacagtgtctcaagttcaaaaaaagcattccctaaacactaggtgaattgggttt
ttgtcccttgaaaatattcagaagttaatgcaaactttttgaaagcatcccttacagatt
ttataggtgttataaatacctccttgtctcccatcctttctttaccccatttcattctgg

 1.07 Intr +  11948  12234  287  2  2  115   57   182 0.210  14.79
acccacaagtagaaattatccccacttcactgaggaggaacctgacattttccttggaga
gccagagtcgcttgctggagatgctgcagttgggaagaactgcactttgaatccagatct
gtgtccgaggctctcagctcttcccctgtgccgcgctggcctgccttcccgcttccctag
GCCTGTGGACTCTCTTCCCTCTGCCTGCACTGTCTTCATCTGTTTCGCCTTCCTGGAGGA
CTCCTACACACCCGTCAAGGCCCGGTGTGAATGTTCCCTCTGCTCGGATGCCCTCCTTGT
CTTTGTGGTGTTGGTGTCCCGTATGGTGGTCGTGTGCATGTCTGTTTCTTCAACTCCTTG
GCGAAGTCCTCCTGGAGAGAGGGACTTTGTCCCTTTGGTGGTGGTATCCTTGGCGGGGAA
TCCCCATCCTTCATGGTTAGATGGCTGCCAATCTCTTTCCCCCATGG
gtgtgttgctcccttgagtgggcccaagtcatgggctgaatcctgggtcataggcttttc
ccagcacgtgctggctgtccactcctttgtctcttgcttatagaagagaacccgtaatgc
ctgggttcaaatttcagctctacttcttatgggctgtaggcgcctgggacagaatcctac

 1.08 Intr +  29002  29159  158  2  2   82   84   322 0.753  30.93
tgacaagggcagcggatgagtgcttccctcctgtcctctgcacatggtgctcccagggaa
ctgcaccggtctcctgctgtgctgctccaggcgcactcgtggctcacagcctctccccag
ggacatgacatgggggtgttttaacgcagcaccatgttctcttttcgcttttggccacag
ATGACGTCCGGTTGTTTGCCTTCGTGCGCTTCACCACCGGGGATGCCATGAGCAAGAGGT
CCAAGTTTGCCCTCATCACGTGGATCGGTGAGAACGTCAGCGGGCTGCAGCGCGCCAAAA
CCGGGACGGACAAGACCCTGGTGAAGGAGGTCGTACAG
gtactgagttcctccagagtctggaggtcaaagctcgccaagggtcaccatcctgcaagg
agggagagggctgggttcgactcctgggtctgtagcttagctgtgacttgggacaagcca
tgctatgtctctgcaccagtaaagccattggtgaaatgtcaccagaattgtttcaggatg

 1.09 Intr +  35175  35202   28  2  1  115   32    44 0.238  -0.81
gcagcaggggctgccaggcaagctgggcagggcgattgcgatgcccagactccagtccgg
ggaatgcgctgaacgcacagcacgcacggctggctggccacagctgttgtctgccacaca
gaagtacccggctggtgcccaggacagaacctcgctcctatcgttctcgtgtctctgcag
GATTGTGGGGACAATGCAGTGACCGCTG
gtagtgacctgcgatgtgccagggccaggctctcttgatttagagccatgcttggtcagt
gctgcatcatgcttgtcttgcaggatgggttcattcacctgatccttttattgattcttt
aacataatatgaacgttcacggagccaggaatccagaaggcatgcagctcagctttcagg

 1.10 Intr +  39199  39281   83  2  2   63   50    78 0.272   0.86
acagtctcctaggagaaagaaggagatccctgcaccctaggtttgggcctggcatgtaaa
taaagccacctgaataagcaaagaattctgcccagcgggctgtgacctggctgccctcca
ccaaactccagaccagtgccagcccttggccagcctgccctagcctggtacctgccccag
GCACCTGCCAGCAGCTGGCCTCCGGACGCTGTGGTGCAGTGATTCCCGACACAGTCGCTA
GCACGGTATACAGTCGCTGTGCC
gtgaggatgcagcattcgaacgtgtacaggtcttaacctgaagaaatgaatctggagagc
tctttgtgtgtgaagtgcatgtttcccagccttcatgaaaggccgaaggctcactgcact
ctacatcttgcccctgtgtatgagtgtctttcctccccctcttctcttcctcttccctgg

 1.11 Term +  52309  52419  111  0  0  102   40   214 0.401  16.56
tgttcaatttccattgactctgctgctgaatttccattgactgactctgctgctgaattt
ccatttccatctctcatcagggttttcagtgctttgcttcccagtgtgttgcctgagcca
ccctcacatcctgtgccttccttcttaataggaacgctgtgttttcctttgttcttgcag
AATTTCGCTAAGGAGTTTGTGATCAGTGATCGGAAGGAGCTGGAGGAAGATTTCATCAAG
AGCGAGCTGAAGAAGGCGGGGGGAGCCAATTACGACGCCCAGACGGAGTAA
ccccagcccccgccacaccaccccttgccaaagtcatctgcctgctccccgggggagagg
accgccggcctcagctactagcccaccagcccaccagggagaaaagaagccatgagaggc
agcgcccgccaccctgtgtccacagcccccaccttcccgcttcccttagaaccctgccgt

Predicted peptide sequence(s):


>COTL1_1|GENSCAN_predicted_peptide_1|353_aa
MATKIDKEACRAAYNLVRDDGSAVIWVTFKYDGSTIVPGEQGAEYQHFIQQCTVGSKLSD
NGSTARRDNGLNTGTGWIAVTTLDVPYLGHTSEQPGVAAQFAWDGQRPCEGGEKCPVQIN
KMMKDDRCVSSWPVDSLPSACTVFICFAFLEDSYTPVKARCECSLCSDALLVFVVLVSRM
VVVCMSVSSTPWRSPPGERDFVPLVVVSLAGNPHPSWLDGCQSLSPMDDVRLFAFVRFTT
GDAMSKRSKFALITWIGENVSGLQRAKTGTDKTLVKEVVQDCGDNAVTAGTCQQLASGRC
GAVIPDTVASTVYSRCANFAKEFVISDRKELEEDFIKSELKKAGGANYDAQTE