GENSCAN 1.0	Date run: 15-Jan-104	Time: 12:12:24

Sequence CLDN9_1 : 3053 bp : 62.76% C+G : Isochore 4 (57 - 100 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Sngl +   1231   1854  624  0  0   70   54   964 0.500  85.44
ctttcatggaactgaggactggcctggcttggggacaccaacaagccttccccctcctgc
tggacacagagacacccacccagcacaccagacacaccctctgagtcacctaggccgcct
ggggctgagaagacctaaccgaggggccagatggcttcgaccggcttagaactgctgggc
ATGACCCTGGCTGTGCTGGGCTGGCTGGGGACCCTGGTGTCCTGCGCCCTGCCCCTGTGG
AAGGTGACCGCCTTCATCGGCAACAGCATCGTGGTGGCCCAGGTGGTGTGGGAGGGCCTG
TGGATGTCCTGCGTGGTGCAGAGCACGGGCCAGATGCAGTGCAAGGTGTACGACTCACTG
CTGGCTCTGCCGCAGGACCTGCAGGCCGCACGTGCCCTCTGTGTCATTGCCCTCCTGCTG
GCCCTGCTTGGCCTCCTGGTGGCCATCACAGGTGCCCAGTGTACCACGTGTGTGGAGGAC
GAAGGTGCCAAGGCCCGTATCGTGCTCACCGCGGGGGTCATCCTCCTCCTCGCCGGCATC
CTGGTGCTCATCCCTGTGTGCTGGACGGCGCACGCCATCATCCAGGACTTCTACAACCCC
CTGGTGGCTGAGGCCCTCAAGCGGGAGCTGGGGGCCTCCCTCTACCTGGGCTGGGCGGCG
GCTGCACTGCTTATGCTGGGCGGGGGGCTCCTCTGCTGCACGTGCCCCCCGCCCCAGGTC
GAGCGGCCCCGCGGACCTCGGCTGGGCTACTCCATCCCCTCCCGCTCGGGTGCATCTGGA
CTGGACAAGAGGGACTACGTGTGA
ggcggaggtttcccctgggagcccactgctccccactgccccgccctttcgaccttggcc
tgatgaccagatgccctgctccatcacaacctccttccccaggaaaacccactttccaaa
agcccaagctacacctggctgcagggctgggtcagctggcctggctgagctcttctcagt

Predicted peptide sequence(s):


>CLDN9_1|GENSCAN_predicted_peptide_1|207_aa
MTLAVLGWLGTLVSCALPLWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSL
LALPQDLQAARALCVIALLLALLGLLVAITGAQCTTCVEDEGAKARIVLTAGVILLLAGI
LVLIPVCWTAHAIIQDFYNPLVAEALKRELGASLYLGWAAAALLMLGGGLLCCTCPPPQV
ERPRGPRLGYSIPSRSGASGLDKRDYV