GENSCAN 1.0	Date run: 15-Jan-104	Time: 11:45:16

Sequence CDH1_1 : 100649 bp : 46.98% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1325   1372   48  1  0   96   80   188 0.995  17.76
ggtacggggggcggtgcctccggggctcacctggctgcagccacgcaccccctctcagtg
gcgtcggaactgcaaagcacctgtgagcttgcggaagtcagttcagactccagcccgctc
cagcccggcccgacccgaccgcacccggcgcctgccctcgctcggcgtccccggccagcc
ATGGGCCCTTGGAGCCGCAGCCTCTCGGCGCTGCTGCTGCTGCTGCAG
gtaccccggatcccctgacttgcgagggacgcattcgggccgcaagctccgcgccccagc
cctgcgccccttcctctcccgtcgtcaccgcttcccttcttccaagaaagttcgggtcct
gaggagcggagcggcctggaagcctcgcgcgctccggaccccccagtgatgggagtgggg

 1.02 Intr +   2206   2320  115  0  1  107   78   139 0.604  14.82
cggccgtaggtttcggggtgggggagggtgacgtcgctgcccgcccgtcccggggctgcg
ggctggggtcctcccccaatcccgacgccgggagcgagggaggggcggcgctgttggttt
cggtgagcaggagggaaccctccgagtcacccggttccatctacctttcccccaccccag
GTCTCCTCTTGGCTCTGCCAGGAGCCGGAGCCCTGCCACCCTGGCTTTGACGCCGAGAGC
TACACGTTCACGGTGCCCCGGCGCCACCTGGAGAGAGGCCGCGTCCTGGGCAGAG
gtgagggcgcgctgccggtgtccctgggcggagtagggaggggttggaaaggggccgaga
aattgcactcccacacccctgggttgcaatgggcaagctccctccttggctcaaacgaca
ccccttggaatttacgcagatttggggatccaaacgtttacgactgaacactgtggtgga

 1.03 Intr +  65579  65802  224  0  2   90   91    86 0.894   6.95
tcatcctgtagttgtgaagaacattatggtgatagctttgttgttctgtcaccagattat
ggtttgttttggttgtgtttggttttgtgggagtcttcccacaagttcgctctttggaga
aggaatgctcttgtctttaatctgtccaatttcctaatctctgtgatttctgccctgcag
TGAATTTTGAAGATTGCACCGGTCGACAAAGGACAGCCTATTTTTCCCTCGACACCCGAT
TCAAAGTGGGCACAGATGGTGTGATTACAGTCAAAAGGCCTCTACGGTTTCATAACCCAC
AGATCCATTTCTTGGTCTACGCCTGGGACTCCACCTACAGAAAGTTTTCCACCAAAGTCA
CGCTGAATACAGTGGGGCACCACCACCGCCCCCCGCCCCATCAG
gtatgttggcatttttctgagaagttcgctgttgttttagtgcgctgtctaatccaggtt
tctcagccttggtaccgttgacattttgggctggatgattttgtgttgtaggggttgtcc
tgtgcactgtgtaggatgtttagcaagcatccctggccttaactggttagacaccagtag

 1.04 Intr +  72333  72476  144  2  0  121   80    24 0.960   5.38
tttgattggtcattttggtggatatatataatttgtcattgataagagaatgtgtcatta
aattcaaactgtacactgcccacagaaggctggggacgctgtctggctaggttggactgt
tagacctgaagtatccgtcttgaattgtcttatcttgttcctcatcttctttccttttag
GCCTCCGTTTCTGGAATCCAAGCAGAATTGCTCACATTTCCCAACTCCTCTCCTGGCCTC
AGAAGACAGAAGAGAGACTGGGTTATTCCTCCCATCAGCTGCCCAGAAAATGAAAAAGGC
CCATTTCCTAAAAACCTGGTTCAG
gtagagaaagaagttctctgtttctctgggagggatttggcagagaagtaccaaggagag
aaagggaaaagacccagtgttgggatccttctttactaattctttttctttcattttgtc
ttcagatcaaatccaacaaagacaaagaaggcaaggttttctacagcatcactggccaag

 1.05 Intr +  72602  72757  156  1  0  128   93   171 0.995  21.81
tcccatcagctgcccagaaaatgaaaaaggcccatttcctaaaaacctggttcaggtaga
gaaagaagttctctgtttctctgggagggatttggcagagaagtaccaaggagagaaagg
gaaaagacccagtgttgggatccttctttactaattctttttctttcattttgtcttcag
ATCAAATCCAACAAAGACAAAGAAGGCAAGGTTTTCTACAGCATCACTGGCCAAGGAGCT
GACACACCCCCTGTTGGTGTCTTTATTATTGAAAGAGAAACAGGATGGCTGAAGGTGACA
GAGCCTCTGGATAGAGAACGCATTGCCACATACACT
gtaagtatctcttagaagcttgttgacaccggggtaacatccacccaggattttttggtc
aacccatgctggatccgcagatcagaggctctgaacacatgaggagcttaacttgacacc
tcttgacctgttgctaaggagaagtgatgggagaacgtgggacagtttggggttgttaat

 1.06 Intr +  74106  74250  145  2  1   83   76   140 0.925  12.16
taccttgttataatctcactgaagcagcagcagcacatgtgtgagaaaagtcacccactg
ggggtctcagagcctaggaaggtgtggcagccaggggggcgcactctgctctggctgggc
cccttctcccatgttttcttcctcatcagagctcaagtcaccctcacttggttctttcag
CTCTTCTCTCACGCTGTGTCATCCAACGGGAATGCAGTTGAGGATCCAATGGAGATTTTG
ATCACGGTAACCGATCAGAATGACAACAAGCCCGAATTCACCCAGGAGGTCTTTAAGGGG
TCTGTCATGGAAGGTGCTCTTCCAG
gtatatccactaatgagaatctgaatactcagaaagactcttaggttctttggaccccaa
agtgttgtccaagcccaaaggttgtgtaactaaagctgatccttcctacggacagaactt
cttggcaagccattgttgtgttatatgcatgtgtgtaacagtctacctgtggaaacatat

 1.07 Intr +  75593  75768  176  0  2   98   55   273 0.985  24.66
tagtttgagctttctttctcccctagcactttggtaagaattctaggaattagggaactc
tgacacggtaccacccccatgtcccctcctttatccctcagggcagaattggattaagca
gtattgacccagtcccaaagtgcagcttgtctaaaccttcatctccttgaactcttccag
GAACCTCTGTGATGGAGGTCACAGCCACAGACGCGGACGATGATGTGAACACCTACAATG
CCGCCATCGCTTACACCATCCTCAGCCAAGATCCTGAGCTCCCTGACAAAAATATGTTCA
CCATTAACAGGAACACAGGAGTCATCAGTGTGGTCACCACTGGGCTGGACCGAGAG
gtcaggggtcaggaggatccagagggtgtggaggacaaatgtgtattagctcaatcccgt
ggacaaagcaaaatcctgctaggccagttgtcagttaatacagtgatggtctaagctttg
catctaagcttgtgcccagaggttccgtgcctagaagacaggcaggctggcatgaagcac

 1.08 Intr +  76044  76172  129  2  0  100   43   102 0.995   7.79
taatacagtgatggtctaagctttgcatctaagcttgtgcccagaggttccgtgcctaga
agacaggcaggctggcatgaagcacatggttaaatattctggttccatgtgttgggctgg
gctaggccaaaggtggctagtgttcctggtcctgacttggttgtgtcgatctctctgcag
AGTTTCCCTACGTATACCCTGGTGGTTCAAGCTGCTGACCTTCAAGGTGAGGGGTTAAGC
ACAACAGCAACAGCTGTGATCACAGTCACTGACACCAACGATAATCCTCCGATCTTCAAT
CCCACCACG
gtaattctataactccttagagggtttccaaagaaaggtcttttgttgttcatgaactaa
gtgtcaccactgctcatgggcgaagtctttgaaaactctctccagactagagaatgttaa
ctttaaacttaaaagcaagcatcttgagatggcagttgtcttttagtatcttttttccac

 1.09 Intr +  77222  77404  183  1  0   99   76   185 0.904  18.38
cttgagcccaggaggttgaggctacagtgagccatgatcgctcaaatacactccagcctg
gtgacagtgagatcttatctcaaaagaacaacaaaaaaagaggaatcctttagccccctg
agactcagctctgctagcagtcttggtactttgtaaatgacacatctctttgctctgcag
TACAAGGGTCAGGTGCCTGAGAACGAGGCTAACGTCGTAATCACCACACTGAAAGTGACT
GATGCTGATGCCCCCAATACCCCAGCGTGGGAGGCTGTATACACCATATTGAATGATGAT
GGTGGACAATTTGTCGTCACCACAAATCCAGTGAACAACGATGGCATTTTGAAAACAGCA
AAG
gtttgtatggtacctggcaagatgcagaaactggcatcctcacagctgttcatacccttg
tcccctggtatcttcttagaagtagattcgctttggcagggggacagggtgactttccca
gattgtagtggaccatgtgggatttgcagtggctcttcctgctcatgtaagaaatcaaga

 1.10 Intr +  79424  79668  245  1  2  111  111   322 0.999  33.10
agatttgagaagccatggtaagtaattgtggtttctgccattgaaagtcatggcagaaac
cacagttacttttgcaccaacctaatatattaccaaaagcaacagttaaggatttaattt
tatttttactaacacaaaatgtttcgttttgtttttaacttcattgtttctgctctctag
GGCTTGGATTTTGAGGCCAAGCAGCAGTACATTCTACACGTAGCAGTGACGAATGTGGTA
CCTTTTGAGGTCTCTCTCACCACCTCCACAGCCACCGTCACCGTGGATGTGCTGGATGTG
AATGAAGCCCCCATCTTTGTGCCTCCTGAAAAGAGAGTGGAAGTGTCCGAGGACTTTGGC
GTGGGCCAGGAAATCACATCCTACACTGCCCAGGAGCCAGACACATTTATGGAACAGAAA
ATAAC
gtaagtgtgaggatttttcaactgacttgcagcaactggttattttatatcattttatat
gtaaatcaataatatgtacttcatggcattttgtcatttgtctgtacaagaccattctct
taatttattttttattccctttatctgtgctcctttcacctgttcccttcccttcacaga

 1.11 Intr +  83189  83334  146  2  2   60   91   171 0.802  14.53
cccacctcagcctcccaaagtgttgggattacaggcatgagccaccgcgaccggcctatt
gttggttttcaaaataaaaacgttggaagtaaccatataactgaagaagcgcttaagccg
ttttcagctacatgttgtttgctggtcctattctaaaagccagagcttgtccccgttcag
ATATCGGATTTGGAGAGACACTGCCAACTGGCTGGAGATTAATCCGGACACTGGTGCCAT
TTCCACTCGGGCTGAGCTGGACAGGGAGGATTTTGAGCACGTGAAGAACAGCACGTACAC
AGCCCTAATCATAGCTACAGACAATG
gtaagggggcctcatctgagcctttgctgcctcgacctcctagctagttcagttccttgc
ccctcccttcttttggagggaagagttcattctttttcttttatcctttttgtttgctgg
attgatttgtataaatgtatggagtacaagggtaattttgttacatgcatagatgtgtag

 1.12 Intr +  85910  86134  225  0  0   94   39   226 0.978  16.26
ctgcccacctgggagtggaggtcctttgggattggtgggacaggaggttctgcgggtgga
gtggggcctggtgagggaccactgaagagccaggacaagatctagacttggtctggtgga
aggcaatggggattcattactgttgccaagctgccacattttctgtgtattttctcttag
GTTCTCCAGTTGCTACTGGAACAGGGACACTTCTGCTGATCCTGTCTGATGTGAATGACA
ACGCCCCCATACCAGAACCTCGAACTATATTCTTCTGTGAGAGGAATCCAAAGCCTCAGG
TCATAAACATCATTGATGCAGACCTTCCTCCCAATACATCTCCCTTCACAGCAGAACTAA
CACACGGGGCGAGTGCCAACTGGACCATTCAGTACAACGACCCAA
gtgggtacctgagttttattttggcaactttgctccaactgccatgcttcccttccccca
gatccccacctttcaatttcccttctcaacttctagatgtcaccccttccattgatactt
gcttccttgtcccttctgtctttgaggccttgctccaaaggtctttttcctttcctggta

 1.13 Intr +  86473  86928  456  2  0   43   28   506 0.619  33.29
aggtctttttcctttcctggtatctaactttgtagcatgctacccagtaatctaaaaccc
aagcagggctccctctcccagcctctagccaccctccactcccctctccacttgcaacca
ggaccatcttctctgctacctcctgctcctgggaccaaacaacaccatttttgtggttag
CTCCTTCTTGCCAACCAATCGTGAGCTCCCAGATTCATCAGAACTATTCTACCGAGGTGG
AGGCAGCTGTCAACTGCCTGGTCAATTTGCATATATGGGCTTCCTACACCTACTTCTCTC
TGGGCTTCTATTTCCACCATGACGATGTGGATCTGGAAGGTGTGCACCACTTCTTCCACA
AATTGGCCAAGGAGAAGCACAAGGGCGCTGAGTGTCCCTTGAAAATGCAAAACCAGTGTG
GCGGCCGCACTGTCTTCCCGGACATCCAGAAGCCATGTAAAGATGAATGGGGTAAAACCC
TGGGTGCGATGGAAGTCACTCTGGCCCTGGAGAAGAACCTGAACTGGACCCTTTTGGATC
TTCATGCCTTGGGTTCCACCTGCACAGACCCCCATATCTGTGACTTCCTGGAGAGCCACT
TCCTAGATGAAAAAGTAAAACTCATCAAGAAGATAG
gtgaccacctgaccaaccttcacaggccagccggcctccaggccgggctgggcaaaaagg
ttcaccctcaggcacacgggagcctaccgaacccagcgacatctgaagagccccgctctg
cctaagcctctccctccagccactaggcagcttttttaaaccaactctagagccctctcc

 1.14 Intr +  87308  87535  228  0  0   92   97   154 0.658  14.54
aaataaagctttttacagcaaaaaaaaaaaaaaaaaagtacatacctaaataaaacccaa
gcagctctgctctcttcactcggcttgcgggtgtctttagttcactagcaattttattct
ggaatgagctttttattttcctcccctggtctcatcatttctttttattgctttctccag
CCCAAGAATCTATCATTTTGAAGCCAAAGATGGCCTTAGAGGTGGGTGACTACAAAATCA
ATCTCAAGCTCATGGATAACCAGAATAAAGACCAAGTGACCACCTTAGAGGTCAGCGTGT
GTGACTGTGAAGGGGCCGCTGGCGTCTGTAGGAAGGCACAGCCTGTCGAAGCAGGATTGC
AAATTCCTGCCATTCTGGGGATTCTTGGAGGAATTCTTGCTTTGCTAA
gtaagtccagctggcaagtgactcagcctttgacttaaaaaaatggaggaggtttatttc
ctggaaatgatttttgttcttatattaataaggatataggttagctgatgtgggaaagag
actcccaagttatgccagcctccataaaatagaagtttgtctcttactgaacatttcaga

 1.15 Intr +  92083  92213  131  2  2   70   94   164 0.999  15.61
acataccgacttcagggatgtgagtgtcacgtggattgacatcttcaagtgtattgaagg
cagctagtggctgtctaactgccccctgtctggtatgaggggtgctctgtgatagctgct
gcttctggccttctttatctttggctctcaacacttgctctgtctcccccaccatcccag
TTCTGATTCTGCTGCTCTTGCTGTTTCTTCGGAGGAGAGCGGTGGTCAAAGAGCCCTTAC
TGCCCCCAGAGGATGACACCCGGGACAACGTTTATTACTATGATGAAGAAGGAGGCGGAG
AAGAGGACCAG
gtgggttttgaaaaccttggtagctcagtggtgatctctttattcggaagaagcaatgat
tagtaagaggtaggcatttgaaacagctctgaatcactttggatattatctttttaaggc
cttacccaagaaagtagacattgtcattgaccatcatcatcatcacatcatcaccaacac

 1.16 Intr +  93563  93706  144  1  0   74  100   120 0.999  12.28
ttccagtgctatttgggagacttttagcttgaaaactgtcattttgcattaaactggtaa
agatcatacagttggcagtgaaggcatcatccaaccataatctataaactgaacatagcc
ctgtgtgtatgactatttctttcctactcttcattgtacttcaaccttttttctccaaag
GACTTTGACTTGAGCCAGCTGCACAGGGGCCTGGACGCTCGGCCTGAAGTGACTCGTAAC
GACGTTGCACCAACCCTCATGAGTGTCCCCCGGTATCTTCCCCGCCCTGCCAATCCCGAT
GAAATTGGAAATTTTATTGATGAA
gtaagtaatccacgtggaaagccaaagcatggctcatctctaagctcaggaggagttgtg
tcaaaaatgagaaaaagagtctttagattctttcctttactatgttttcagcttgcctga
gccctggagccctgttttcctttttctttttttttctttttctttttttttttttttgag

 1.17 Term +  97199  97408  210  1  0   95   50   334 0.999  27.59
tgtgcttctgcatccttccatgacagtgtgtataaatgtacgttgttggtgttcactgct
ccgtggtgtgccacaagtctgggtgcattgtcgtaccttacatattgctagacttcttgc
cccagatgacaggtgtgcccttcctttcactaaaagatgcttttgtcccttcttctttag
AATCTGAAAGCGGCTGATACTGACCCCACAGCCCCGCCTTATGATTCTCTGCTCGTGTTT
GACTATGAAGGAAGCGGTTCCGAAGCTGCTAGTCTGAGCTCCCTGAACTCCTCAGAGTCA
GACAAAGACCAGGACTATGACTACTTGAACGAATGGGGCAATCGCTTCAAGAAGCTGGCT
GACATGTACGGAGGCGGCGAGGACGACTAG
gggactcgagagaggcgggccccagacccatgtgctgggaaatgcagaaatcacgttgct
ggtggtttttcagctcccttcccttgagatgagtttctggggaaaaaaaagagactggtt
agtgatgcagttagtatagctttatactctctccactttatagctctaataagtttgtgt

Predicted peptide sequence(s):


>CDH1_1|GENSCAN_predicted_peptide_1|1034_aa
MGPWSRSLSALLLLLQVSSWLCQEPEPCHPGFDAESYTFTVPRRHLERGRVLGRVNFEDC
TGRQRTAYFSLDTRFKVGTDGVITVKRPLRFHNPQIHFLVYAWDSTYRKFSTKVTLNTVG
HHHRPPPHQASVSGIQAELLTFPNSSPGLRRQKRDWVIPPISCPENEKGPFPKNLVQIKS
NKDKEGKVFYSITGQGADTPPVGVFIIERETGWLKVTEPLDRERIATYTLFSHAVSSNGN
AVEDPMEILITVTDQNDNKPEFTQEVFKGSVMEGALPGTSVMEVTATDADDDVNTYNAAI
AYTILSQDPELPDKNMFTINRNTGVISVVTTGLDRESFPTYTLVVQAADLQGEGLSTTAT
AVITVTDTNDNPPIFNPTTYKGQVPENEANVVITTLKVTDADAPNTPAWEAVYTILNDDG
GQFVVTTNPVNNDGILKTAKGLDFEAKQQYILHVAVTNVVPFEVSLTTSTATVTVDVLDV
NEAPIFVPPEKRVEVSEDFGVGQEITSYTAQEPDTFMEQKITYRIWRDTANWLEINPDTG
AISTRAELDREDFEHVKNSTYTALIIATDNGSPVATGTGTLLLILSDVNDNAPIPEPRTI
FFCERNPKPQVINIIDADLPPNTSPFTAELTHGASANWTIQYNDPTPSCQPIVSSQIHQN
YSTEVEAAVNCLVNLHIWASYTYFSLGFYFHHDDVDLEGVHHFFHKLAKEKHKGAECPLK
MQNQCGGRTVFPDIQKPCKDEWGKTLGAMEVTLALEKNLNWTLLDLHALGSTCTDPHICD
FLESHFLDEKVKLIKKIAQESIILKPKMALEVGDYKINLKLMDNQNKDQVTTLEVSVCDC
EGAAGVCRKAQPVEAGLQIPAILGILGGILALLILILLLLLFLRRRAVVKEPLLPPEDDT
RDNVYYYDEEGGGEEDQDFDLSQLHRGLDARPEVTRNDVAPTLMSVPRYLPRPANPDEIG
NFIDENLKAADTDPTAPPYDSLLVFDYEGSGSEAASLSSLNSSESDKDQDYDYLNEWGNR
FKKLADMYGGGEDD