GENSCAN 1.0	Date run: 15-Jan-104	Time: 09:12:47

Sequence TGM7_1 : 19751 bp : 48.64% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +   1202   1384  183  0  0  123  117   265 0.998  32.66
cccgcacacacacacccgcacgccccccccgcacaccccacctccccccccgcacgcccc
acctaccccccgcacgccccaccacccgccgcacctcccagaaatgactgagaagccaca
agggatgcctgagcccaggggactgcaggtgggcgtgacctgtcccctcctctcccctag
TGGCAACCTTGCGGCTTGAGTCTGTCGACCTGCAGAGCTCCAGGAACAACAAGGAGCACC
ACACGCAGGAGATGGGCGTCAAGCGGCTCACTGTGCGCCGCGGCCAGCCCTTCTACCTCC
GGCTGAGCTTCAGCCGACCCTTCCAGTCCCAGAACGACCACATCACCTTTGTGGCTGAGA
CCG
gtgagtttgccctgtcccaaggccccgcaggttccgtcaaaatgagggcatttacagagt
ctgcctgcggggcccctgcctttcccacctgagctgccctccactttcttgtcctgggag
ccccagacccctcatgctcaggaccctgttagtgctgttaaggagagatttggtcaactc

 1.02 Intr +   1879   2124  246  2  0   94   91    96 0.829   7.93
acagattaaaaaacggaggcctgggggtcttaaatggtttgcctgaggacactcggtggc
agtaaaagccaaaagcattagcaggtggtgggagaaggtgacggtccttccgactcccct
ggaatcatataccatacaggttttttgagcctcactgtggggtcattctctcctacacag
GACCCAAGCCGTCAGAGCTGCTGGGGACCCGAGCCACATTCTTCCTCACCCGGGTCCAGC
CCGGGAATGTCTGGAGCGCTTCTGATTTCACCATTGACTCCAACTCTCTCCAAGTTTCCC
TTTTCACACCAGCCAATGCAGTTATTGGCCATTACACTCTGAAAATAGAGATCTCTCAGG
GCCAAGGTCACAGTGTGACTTACCCGCTGGGAACTTTCATCCTACTTTTTAACCCTTGGA
GTCCAG
gtaggatgtgcccacagcttgtattgctaacctgatccattgggaaggccctgtgaggtt
ctttggaaaaagcccagaaaataaatcgccacatagctatgcaatgtagtagcgtgtgct
ctcacaaaaatcatctttacaaagaatttctaatggcatgaggaaagtattcatgacgtg

 1.03 Intr +   2736   2854  119  1  2   57   92   157 0.805  13.18
tggcttctagaaaagcacatagtagacctttaagggggtctagtcttaatttctgttgct
atcaacccatcgactgttcctcctgttttccagaaacacgttgtcgttactgttttttaa
tttaatactctgtttttttggtttggggttttgccccctccactactcttaactgctcag
AGGACGACGTCTACCTGCCAAGTGAAATACTGCTGCAGGAGTATATCATGCGAGATTATG
GCTTTGTTTACAAGGGTCATGAAAGATTCATCACCTCCTGGCCCTGGAACTACGGGCAG
gtaacactattacccaatgtgggcctggggtgggctccctaaggctggtccttacacaac
cctgttatgtaaggctgttatattacacagccctcatagagggccactaatacaggcgag
ggtgtgaggggcttggccagcttcacatccagtgagaggggcaaggaaggaaggggtgga

 1.04 Intr +   4185   4808  624  2  0    7   63   262 0.109   8.04
attgcttcaaagagaataaaatacctatgaatccaacttacaagggacatgaaggacctc
ttcaagaagaactacaaaccactgctcaatgaaataaaagaggatacaaacaaatggaag
aacattccatgctcatgggtaggaagaatcagtactgtgaaaatggccatactgcccaag
GTAATTTATAGATTCAATGCCATCCCCATCAAGCTACCAATGACTTTCTTCACAGAATTG
GAAAAAGCTACTTTAAAGTTCATATGGAACCCAAAAAGAGCCTGCATTGCCAAGTCAATC
CTAAGCCAAAAGAACAAAGCTGGAGGCATCACGCTACCTGACTTCAAACTATACTACAAG
GCTACAGTAACCAAAACAGCATGGTACTGGTACCAAAACAGAGATATAGATCAATGGAAC
AGAACAGAGCCCTCAGAAAGAATGCTGCATATCTACAACCATCTGATCTTTGACAAACCT
GACAAAAACAAGAAATGGGGAAAGGATTCCCTATTTAATAAATGGTGCTGGGAAAACTGG
CTAGCCATATGTAGAAAGCTGAAATTGGACCCCTTCCTTACACCTTATACAAAAATTAAT
TCAAGATGGATTAAAGACTTAAATGTTAGACCTGAAACCATAAAAACCCTAGAAGAAAAC
CTAGGCAATACCATTCAGGACATAGGCATGGGCAAGGACTTCATGTCTAAAACCCCAAAA
GAAATGGCAACAAAAGCCAAAATCGACAAATGGGATCTAATTAAACTAAAGAGCTTCTGC
ACAGCAAGAGAAACTACCATCAGA
gtaagcaggcaacctacagaatgggagaaaattttcacaacctactcatctgataaaggg
ctaatatccagaatctacaatgaactcaaacaaatttacaagaaaaaaacaaacaacccc
atcaaaaagtgggcgaaggacatgaacagacacttctcaaaagaagacatttatgcagcc

 1.05 Intr +   7164   7292  129  2  0  -18   91   151 0.385   5.69
tacattcccaatttgatttataagctcttcaaaggcaggaacttgtcttatatttagcgc
cctccccctgcccccacatccccatatacatgccatccccaaaagtctgttagtgactta
aagtttcagaagtctagacatttgctcttctcttttttctcccttaaaatcacttggaag
TTTGAAGAGGACATCATAGACATCTGCTTTGAGATCCTGAACAAGAGCCTGTATCACTTA
AAGAACCCGGCCAAAGACTGTTCCCAGCGGAACGACGTGGTGTATGTGTGCAGGGTGGTG
AGTGCCATG
gtaaggatggatgcttcccgccgtctgaggacagtctgagcttccccgggagctgtggaa
acccacctgtctgtcctctgcagatcaacagcaacgatgacaatggcgtgctgcagggga
actggggcgaggactactccaaaggggtcagtcctctggagtggaagggcagtgtggcca

 1.06 Intr +   7376   7553  178  1  1   87  105   182 0.998  19.29
gatcctgaacaagagcctgtatcacttaaagaacccggccaaagactgttcccagcggaa
cgacgtggtgtatgtgtgcagggtggtgagtgccatggtaaggatggatgcttcccgccg
tctgaggacagtctgagcttccccgggagctgtggaaacccacctgtctgtcctctgcag
ATCAACAGCAACGATGACAATGGCGTGCTGCAGGGGAACTGGGGCGAGGACTACTCCAAA
GGGGTCAGTCCTCTGGAGTGGAAGGGCAGTGTGGCCATCCTACAGCAGTGGTCAGCCAGG
GGCGGGCAGCCTGTGAAGTACGGACAGTGCTGGGTCTTCGCCTCTGTTATGTGCACCG
gtgagcgaaagatcactcacttaggggtgtgattaacttcattatcagagaagttaactg
tggctcataaaggttcagtagcttgcccatggccccacagctgggggtggtgggcaccca
ggccctgagctagcacaccatacagtctcgagggatcctgtgcatttatgtgagaggggg

 1.07 Intr +   9881  10019  139  0  1   84   81   140 0.999  12.42
ctgatggggcagcagggctgtgggactgggtgtggggctctgggaataaaggagttactg
gtgtggttccgtaagcgtcttggctttctctcctccagcttgaaagttacaaattatgca
tggaaaaccaataattctgcctgaaatgaactcagcgattctctatatttttctctttag
TAATGAGATGCTTAGGTGTTCCAACCCGTGTTGTTTCCAATTTCCGTTCCGCGCACAACG
TGGATAGGAACTTGACCATCGATACGTACTATGACCGAAATGCCGAGATGCTGTCAACTC
AGAAACGAGACAAAATATG
gtgagaggcactgtcttgaacagatctctgctttgtcccagggagggcagaaaaactgac
ctggttctctctggctcttgaggaaatattgcaagattgccctgagcattgctgctaatg
ctcagagaagagaagaattccccaacccaggaggctgttctggctaattaggtcatcaaa

 1.08 Intr +  12213  12316  104  0  2   97   89    93 0.998  10.12
gggattacaggcgtgagtcaccgcgcccagcctgtactattcttgtgacttttagtatga
aattacttcctaataaaaagtaagaaaaagaaacaatgatataaatcactccgtatagtg
cctggtacctggcaaaacctcagctaacatgaatccttgtctccttactccctcctgcag
GAACTTCCACGTCTGGAATGAGTGCTGGATGATCCGGAAAGATCTCCCACCAGGATACAA
CGGGTGGCAGGTTCTGGACCCCACTCCCCAGCAGACCAGCAGTG
gtgagtgaggaccattgcaacaggctctggctctgtggggaggcagattagggtgactgg
ccgtgggagcaggagaccagggaggagcagcgttttccacggcaccctcttcccgaggtc
ccagctgacacagcttcagatcaggaatctaactctaccattgacagagtcacccggatg

 1.09 Intr +  12747  12989  243  1  0  112   48   308 0.984  26.67
ttgccacttcacagggtggctgtgagggtcagatgaattaatgggaacaaaagtgcttgg
taaactggaagatatcccacgggtgagagtcagtggtgccgctgcctatcccatctccac
ctcccacagccacaaccagctgcccctggcccccatatcagtagcctgttgcctccacag
GGCTGTTCTGCTGTGGCCCTGCCTCTGTGAAGGCCATCAGGGAAGGGGATGTCCACCTGG
CCTATGACACCCCTTTTGTGTATGCCGAGGTGAACGCCGATGAAGTCATTTGGCTCCTTG
GGGATGGCCAGGCCCAGGAAATCCTGGCCCACAACACCAGTTCCATCGGGAAGGAGATCA
GCACTAAGATGGTGGGGTCAGACCAGCGCCAGAGCATCACCAGCTCCTACAAGTACCCAG
AAG
gtgctgggcgggtatttggggaaagggctgctttaagcttctttgtgatgcttcctagct
gggatggctccaagttgaaaccatcaccatcgaatcacctcttcctcatggcaaactcct
aggggtccttcctggatcccaggcatgtggccctagggtagggttaccagcaaataaaaa

 1.10 Intr +  14882  15208  327  0  0  129   96   306 0.965  31.17
acagaacagaacactgagagattaaaggactgtgacagagcaaggatttgaacccagcaa
gcagcacctgagccgcgccgcctccctgtgctgctattcctgtgccttgttgccccagga
aagtcactggtcctctccacccctccccatgcatgtctctcctacctctcccttctgcag
GATCCCCTGAGGAGAGAGCTGTCTTCATGAAGGCTTCTCGGAAAATGCTGGGCCCCCAAA
GAGCTTCTTTGCCCTTCCTGGATCTCCTGGAGTCTGGGGGTCTTAGGGATCAGCCAGCGC
AGCTGCAGCTTCACCTGGCCAGGATACCCGAGTGGGGCCAGGACCTGCAGCTGCTGCTGC
GTATCCAGAGGGTGCCAGACAGCACCCACCCTCGGGGGCCCATCGGACTGGTGGTGCGCT
TCTGTGCACAGGCCCTGCTGCATGGGGGTGGTACCCAGAAGCCCTTCTGGAGGCACACAG
TGCGGATGAACCTGGACTTTGGGAAGG
gtgagtgtgaggcaggcctgagaaggcacctacagggaggggagctgtgggtccatgaac
acagtggggtgggcccagccagattacacacagaccccttcctccaacacacacacattc
tgggcagtgaagctgccagctgctgcacctctgatgccaccccaccaggcgagacggagc

 1.11 Intr +  15556  15716  161  2  2   51   57    95 0.823   2.41
ggcgagacggagcagtgagccctggggacagtgtgtgcgtggtgggacgctgtctgtctg
tctctcacacacacttttacctctcacgtgaaaattctaatttttcctctctcacatcta
catgtcccccctctctctggtccatgtcctggactcaaggtgtcttttgtatgtgcttag
AGACACAGTGGCCGCTCCTCCTGCCCTACAGCAATTACAGAAACAAGCTAACGGACGAAA
AGCTCATCCGCGTGTCTGGCATCGCGGAGGTTGAAGAGACAGGGAGGTCCATGCTGGTCC
TAAAAGATATCTGTCTGGAGCCTCCCCACTTGTCTATTGAG
gtagtgtctggacatgggtgggggctctgaggctctctgactcacccaatccaggggctg
gggtgcagcagccaacaagacactgttcccacctctcaccacaccgatggctccagcaca
gtatggtgtggtctagtgctctgtaccagcgtggggttggaggggcatgaaggcttctca

 1.12 Intr +  17838  17971  134  2  2  102   83   148 0.996  15.14
ggcctgtatatgtgttaatctcaagtactctcagctcacattcctccctcgccactgtgg
cacattagctctaagccgcagttcctggtggtcgccagggacctgggggtgggggtaact
gaaccagagtgcagaagcgaggccagttgcccatgggattgctgacttctctccacacag
GTGTCTGAGAGGGCTGAGGTGGGCAAGGCGCTGAGAGTCCATGTCACCCTCACCAACACC
TTAATGGTGGCTCTGAGCAGCTGCACGATGGTGCTGGAAGGAAGCGGCCTCATCAATGGG
CAGATAGCAAAGGA
gtaagtgacgcttctgcccacctcccccttgctggtctcaggaaaggggtgccccatggc
gtcacaggaccctcctcagtctcctgtgcagtgcctctctgcccccactttctcaccctc
ctcaggaaaggctgagctcagtggtggtggtgagtgggagcctcttacccacccagaggg

 1.13 Term +  18219  18378  160  0  1   56   53   276 0.915  18.31
gaccctcctcagtctcctgtgcagtgcctctctgcccccactttctcaccctcctcagga
aaggctgagctcagtggtggtggtgagtgggagcctcttacccacccagaggggaaccag
atcacccctgccgccagcaggaagtcctcgaggctctcacaggctgtttctgactttcag
CCTTGGGACTCTGGTGGCCGGACACACCCTCCAAATTCAACTGGACCTCTACCCGACCAA
AGCTGGACCCCGCCAGCTCCAGGTTCTCATCAGCAGCAACGAGGTCAAGGAGATCAAAGG
CTACAAGGACATCTTCGTCACTGTGGCTGGGGCTCCCTGA
gacccgccctccagctgccctccctggcacccctgccccacctggctcctttctactcct
ggctatgtcgtcttggctccacctctgtcctctctctagcctgcctgggaatgaatgaag
ctctgttagaaacaccgtgtgctttgggaagagacaataaagatgtctttatttatcacc

Predicted peptide sequence(s):


>TGM7_1|GENSCAN_predicted_peptide_1|915_aa
XATLRLESVDLQSSRNNKEHHTQEMGVKRLTVRRGQPFYLRLSFSRPFQSQNDHITFVAE
TGPKPSELLGTRATFFLTRVQPGNVWSASDFTIDSNSLQVSLFTPANAVIGHYTLKIEIS
QGQGHSVTYPLGTFILLFNPWSPEDDVYLPSEILLQEYIMRDYGFVYKGHERFITSWPWN
YGQVIYRFNAIPIKLPMTFFTELEKATLKFIWNPKRACIAKSILSQKNKAGGITLPDFKL
YYKATVTKTAWYWYQNRDIDQWNRTEPSERMLHIYNHLIFDKPDKNKKWGKDSLFNKWCW
ENWLAICRKLKLDPFLTPYTKINSRWIKDLNVRPETIKTLEENLGNTIQDIGMGKDFMSK
TPKEMATKAKIDKWDLIKLKSFCTARETTIRFEEDIIDICFEILNKSLYHLKNPAKDCSQ
RNDVVYVCRVVSAMINSNDDNGVLQGNWGEDYSKGVSPLEWKGSVAILQQWSARGGQPVK
YGQCWVFASVMCTVMRCLGVPTRVVSNFRSAHNVDRNLTIDTYYDRNAEMLSTQKRDKIW
NFHVWNECWMIRKDLPPGYNGWQVLDPTPQQTSSGLFCCGPASVKAIREGDVHLAYDTPF
VYAEVNADEVIWLLGDGQAQEILAHNTSSIGKEISTKMVGSDQRQSITSSYKYPEGSPEE
RAVFMKASRKMLGPQRASLPFLDLLESGGLRDQPAQLQLHLARIPEWGQDLQLLLRIQRV
PDSTHPRGPIGLVVRFCAQALLHGGGTQKPFWRHTVRMNLDFGKETQWPLLLPYSNYRNK
LTDEKLIRVSGIAEVEETGRSMLVLKDICLEPPHLSIEVSERAEVGKALRVHVTLTNTLM
VALSSCTMVLEGSGLINGQIAKDLGTLVAGHTLQIQLDLYPTKAGPRQLQVLISSNEVKE
IKGYKDIFVTVAGAP