GENSCAN 1.0	Date run: 15-Jan-104	Time: 09:53:11

Sequence SLC24A1_1 : 36337 bp : 46.10% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   3350   4519 1170  1  0  107   38   257 0.054  16.23
tggatcccagatctcctcttagtggtaaataatctcttttttttacccacctagggttgt
ggataccccctggctgggcttcatggagaaatcttctctgatcaccaacctgaatcccag
agtagcctccatcttaggacagaatgagaggccttctgtaaccagatataactggccagc
ATGGGGAAATTGATCAGGATGGGGCCGCAAGAGAGGTGGTTACTCCGGACAAAGCGGCTT
CATTGGAGTCGCCTCCTCTTCTTACTGGGAATGTTGATCATCGGTTCTACTTATCAGCAC
CTTAGGAGACCCCGGGGCCTTTCCTCATTGTGGGCAGCAGTCTCTTCTCATCAGCCTATA
AAACTGGCCAGTCGGGACCTCTCCAGTGAAGAGATGATGATGATGAGCAGCAGCCCTTCA
AAACCTAGCTCCGAAATGGGGGGTAAGATGCTGGTACCCCAAGCCTCAGTGGGCAGTGAT
GAAGCAACACTGAGCATGACAGTGGAGAATATCCCCAGTATGCCTAAAAGAACAGCCAAG
ATGATCCCAACAACAACCAAGAATAATTACAGCCCAACAGCAGCAGGTACAGAAAGAAGG
AAGGAAGACACCCCAACATCCAGTAGAACACTGACTTACTACACCTCAACTTCAAGCAGA
CAAATAGTAAAAAAGTATACCCCAACACCCAGGGGAGAAATGAAGAGCTACAGCCCAACT
CAAGTGAGGGAAAAGGTGAAGTATACTCCTTCCCCACGTGGTAGAAGAGTAGGCACTTAC
GTGCCGTCCACATTCATGACAATGGAAACAAGCCATGCGATCACCCCCAGGACAACAGTG
AAAGACAGTGACATTACAGCAACCTATAAAATACTCGAAACCAACTCTCTTAAGAGAATA
ATGGAGGAAACCACCCCAACCACTCTCAAGGGAATGTTTGATAGCACCCCAACTTTTCTG
ACACATGAGGTAGAAGCAAACGTCTTGACTTCTCCAAGGAGCGTCATGGAAAAAAACAAC
CTGTTTCCCCCCAGAAGAGTGGAAAGTAACAGCTCAGCCCATCCCTGGGGGTTAGTGGGA
AAGAGCAACCCGAAGACTCCCCAGGGAACAGTCCTGTTGCATACCCCAGCCACCTCTGAG
GGGCAGGTGACAATAAGCACCATGACAGGCAGCAGCCCAGCAGAAACCAAAGCCTTCACT
GCTGCCTGGAGTCTTAGGAATCCTTCACCCAGGACCAGTGTATCAGCCATCAAAACAGCC
CCAGCCATAGTCTGGAGGCTGGCAAAGAAACCTTCCACAGCACCCAGCACCTCAACAACC
CCTACGGTCAGGGCAAAGCTGACCATGCAG
gtccatcactgtgtggttgtgaagccaacccccagccatgctcaccactccctccccaag
cctcacaacagccctgctcccagaggagctcagtcctagtccctcagtgctgcctcccag
cttgccagacctccaccccaagggagagtaccccccagatctgttcagtgtggaggagcg

 1.02 Intr +   4662   5240  579  2  0   16  116   858 0.343  74.29
caacaacccctacggtcagggcaaagctgaccatgcaggtccatcactgtgtggttgtga
agccaacccccagccatgctcaccactccctccccaagcctcacaacagccctgctccca
gaggagctcagtcctagtccctcagtgctgcctcccagcttgccagacctccaccccaag
GGAGAGTACCCCCCAGATCTGTTCAGTGTGGAGGAGCGGCGGCAGGGCTGGGTGGTCCTG
CACGTTTTTGGCATGATGTATGTGTTTGTGGCCTTGGCCATTGTTTGCGACGAGTACTTC
GTTCCAGCCCTGGGTGTCATCACAGACAAGCTGCAGATCTCCGAGGATGTGGCAGGCGCC
ACATTCATGGCTGCTGGAGGCTCTGCTCCTGAGCTCTTCACCTCCCTCATCGGTGTCTTC
ATTTCCCACAGCAACGTGGGCATTGGTACCATTGTGGGCTCTGCTGTGTTCAACATTCTC
TTTGTCATTGGCACTTGTTCCCTCTTCTCCCGAGAGATCCTCAACCTCACCTGGTGGCCC
TTATTCCGTGATGTCTCCTTCTACATCCTTGACCTGATAATGCTCATCCTCTTCTTCCTG
GACAGCCTCATTGCCTGGTGGGAGAGCCTGCTGCTGCTGCTGGCCTATGCCTTCTATGTG
TTCACCATGAAGTGGAACAAGCATATCGAGGTCTGGGTGAAGGAGCAGCTCAGCAGGAGG
CCAGTGGCCAAGGTCATGGCCTTAGAAGACCTCAGCAAG
gtaaggacaaattggctcaggtttctctagcccctttgagatgaaaggatgtggcgaagc
caggacctgaagagaaggtgctggatcagacctcaagagatgaatgctctggttccctta
ctatttattcaacatttatagagtacctgttctctgccaggcactgtgctggggcctttg

 1.03 Intr +  17398  17451   54  0  0  103   98    96 0.979  11.28
tgaagccagattatagaaggtcagactggagggatggaacatgttgaaacattttctgag
accaggttatctcggagtgtgtttctgtatttcaacctgaggacttccgtggagaaaggg
atgtagggagaaagtgagggtctcgccacaacatctcgtgactcctctccctgtttgcag
CCGGGCGATGGGGCCATTGCGGTGGATGAGCTACAGGATAACAAGAAGCTGAAG
gtgggtgccgtatggagtctgcccagtggggacactgcagggtctcagtggatgatcaca
ggcccagggtattgtggccctgtgctggggaccctggctgtgctcaggcctaggaaactc
ctgggagcgctgccagggtgaggcaagggaggagagggctctttttctgagaactctcac

 1.04 Intr +  18865  18973  109  0  1   78  121   131 0.983  15.26
gctgagaaagaaagtagtgtaactcttctggttggaggtggaggaagaggggaggtcagg
ataaggcatctgtgctttctccctgatctttatgggaaagaggcaaggttagtgatgccc
tcgtgtggttcctcccctggcttggacaggggcccactgtgcggctctcctcttgctcag
CTCCCGTCCTTGCTGACCCGAGGGAGCAGCTCGACCTCTCTGCACAACAGCACCATCCGC
AGCACCATCTACCAGCTCATGCTCCACAGCCTGGACCCCCTGAGGGAAG
gtaagcaaggcctctccagacctttgtggtttgccccatccactccttccctcctgcagc
tggagaagaactgggacctgaaaatcctagaggcagtgaggagggagtgggaagagataa
taagcagaggaaagtagtaaaagtcagacagtctgggaaagagggtagagaccaagacag

 1.05 Intr +  19033  19137  105  2  0  104   42    35 0.536   0.69
cctcttgctcagctcccgtccttgctgacccgagggagcagctcgacctctctgcacaac
agcaccatccgcagcaccatctaccagctcatgctccacagcctggaccccctgagggaa
ggtaagcaaggcctctccagacctttgtggtttgccccatccactccttccctcctgcag
CTGGAGAAGAACTGGGACCTGAAAATCCTAGAGGCAGTGAGGAGGGAGTGGGAAGAGATA
ATAAGCAGAGGAAAGTAGTAAAAGTCAGACAGTCTGGGAAAGAGG
gtagagaccaagacaggggactcaccaagagagggcaacaaagaacatggaggctaaggt
ccttgggtatccacatcccacttccctgcctctgtccctccctgtaaaatgaaggcatta
acctgcagttaggctgtgagtaccatgtgctctgcacagatttgggatggggctgccctg

 1.06 Intr +  23697  23783   87  1  0   77  100    63 0.979   6.34
aattaggcaccacaactaggcctcgtaggatcagaatccagatgtcacaacccccatggc
agccttttcccacactctgcagctgccctctggctgctcagctgactgtcctaactgaaa
gggcgtggcagggatgatcctacaattccaggtaagatgtatgtcctgtctcatttgcag
TTCGCCTTGCCAAGGAGAAGGAGGAGGAGAGCTTGAATCAAGGGGCCAGAGCCCAACCCC
AGGCCAAAGCAGAAAGCAAACCAGAAG
gtgagaggatggccagaccagtgggttttctcctgcccccctctccctgctgtcagtagt
gagcttggcctggaggcagcagccagccaggccaggggctgaggcacatctttggcctct
gtgagccagtcagttagagtgatggtagggtgttgccctgatcgccgctccactccagac

 1.07 Intr +  24882  24973   92  1  2   59   96   124 0.997  10.01
aggtcagggcaataacaattcacatcatcttacttttcctaccaacaagaaattccccca
aataaaccttcagaaaccctgaagtccaatagccctgtagccacttatgccagtgtctct
gccagcttccttcagaaccttgtccactcttctgatgtaacccatgtttatcctttaaag
AGGAGGAGCCAGCCAAGCTCCCTGCGGTCACGGTCACACCAGCCCCTGTTCCAGACATCA
AGGGAGATCAGAAGGAGAATCCAGGCGGTCAG
gtaggcacccagccttggcacagacaaaattggagaggtctagggaaggaactcttgacc
aaaaatacatcctccctgaaggtctgaaatcctatttgaggttcattcctctgggggtaa
atattaccctttctctgaagatcacttgaaaaatacaagtatctcatggggccaattaac

 1.08 Intr +  29652  30212  561  2  0   58  109   790 0.979  71.11
acagccactaggtaggagtgtggtcatgggaattctgctgaattatcgcactagttttct
cctcatacttaagttttcagataccttctgagaagcacgccaacaaaaaaatgggggagt
aacataaggaaaacaagcagagcagttaccacacattaatctgttggttttggattgcag
GAAGATGTGGCTGAGGCCGAGAGCACAGGTGAAATGCCAGGCGAAGAGGGCGAAACTGCT
GGTGAAGGTGAAACTGAAGAGAAAAGTGGAGGTGAAACTCAACCAGAAGGTGAAGGTGAA
ACTGAAACACAAGGAAAAGGAGAAGAATGTGAAGATGAAAATGAAGCAGAAGGAAAAGGA
GACAATGAAGGTGAAGATGAGGGTGAAATCCACGCAGAAGATGGTGAAATGAAAGGTAAT
GAAGGTGAAACTGAAAGCCAGGAACTCAGTGCTGAAAATCACGGTGAAGCCAAAAATGAT
GAGAAAGGTGTAGAAGATGGAGGGGGAAGTGATGGAGGGGATAGCGAAGAGGAGGAAGAG
GAGGAGGAAGAGCAGGAGGAAGAGGAGGAGGAGGAAGAGCAGGAGGAAGAGGAGGAGGAG
GAGGAGGAAGAGGAGGAGAAGGGAAATGAAGAGCCTCTGTCCCTGGACTGGCCTGAAACC
AGGCAGAAGCAGGCCATTTACCTCTTCCTTCTGCCCATCGTGTTCCCACTGTGGCTGACA
GTCCCCGACGTCCGAAGGCAG
gtgagtgtgcccatctgtatctcagactctttatccccagcagggctgtggggtctctcg
gcatgcggggctcacactcaagaggaggaagaggccagggacaaccagcttatcagggct
ccaccattgagatctgggaagggactgaagccttggagggggactatgtgcttaggggac

 1.09 Intr +  31912  32078  167  0  2   82   84   142 0.309  11.96
cttgctcttcctctctgtggccatctcagctgtcggtccccctatcacccttcctcactc
aggctgagggggtgtggctgagctccttagaaggcagtctgtttgcacaaagtaggatgt
ggatagtgcttggatgtgcctcaggtttttcacctactgttgaccgttgccgtttaccag
GTTGGTGAAACAATAGGGATTTCTGAAGAGATCATGGGCCTGACAATCCTTGCAGCAGGC
ACATCAATTCCTGACCTCATCACCAGTGTGATTGTCGCTCGAAAAGGCCTGGGAGACATG
GCTGTGTCAAGCTCTGTGGGCAGTAACATATTTGATATCACTGTGGG
gtgagtggcaatgtaactttctaaggggtgttaagtatgactggaaaacactgcattggc
tctgttcactggttttctgctttattcattatacatagaataaaagggcatttatattgt
tagtttctgcaaagcaacaaaatatcttcccttcattcatcatagccagatgggataata

 1.10 Intr +  33524  33842  319  2  1   38   72   111 0.083   0.46
gtctgaatcagtcactcttgctcacaatgggcatggatcagaagaccatgcagaagttac
tgtatctcttgtgaccctaatgaaagaatgtatatgatcctggaaagtgaactgggtgac
ctaggacctctgatatgaatgtgatctgagactaaagtttgtccttggaaacacctgcag
CTCATTGTGGATTAAGAACCTCACCCCTGGAGGGGTGGAGTTTCTACCCCTGACTCATGC
AGACATCTATTACATGGAGGCAGTAGAAGGACCCCTGGAGCCAGAGGGTTTTCTAAATGA
GATAACTGGGGGCAAAGGTTGGGATAGGCGCAGCAGCTATAAGACAAGCTCCTACGCTCA
CTGTTCCCTGATCATTCCAAAGGCTGCTGGCCCAAAAGATGCAGATGTGGTCTACATCTC
AGCCTTCCTGACCTCTGCCCCAAACACACGCTGCAATTTTGTCTCCTCCTTTTCTGTTCA
AATTGTGAGGTTCTATCAG
gtttgtaatcactgtagcttcagttattggtgagtctaaggatccaaggctacagaaaaa
aaagaaatataacaggaattaatgatcattccacgttttgtagcccactgcatctggata
tataccagtattttctttttttttttttttgagacagagtttggctcttgttgcccaggc

Predicted peptide sequence(s):


>SLC24A1_1|GENSCAN_predicted_peptide_1|1081_aa
MGKLIRMGPQERWLLRTKRLHWSRLLFLLGMLIIGSTYQHLRRPRGLSSLWAAVSSHQPI
KLASRDLSSEEMMMMSSSPSKPSSEMGGKMLVPQASVGSDEATLSMTVENIPSMPKRTAK
MIPTTTKNNYSPTAAGTERRKEDTPTSSRTLTYYTSTSSRQIVKKYTPTPRGEMKSYSPT
QVREKVKYTPSPRGRRVGTYVPSTFMTMETSHAITPRTTVKDSDITATYKILETNSLKRI
MEETTPTTLKGMFDSTPTFLTHEVEANVLTSPRSVMEKNNLFPPRRVESNSSAHPWGLVG
KSNPKTPQGTVLLHTPATSEGQVTISTMTGSSPAETKAFTAAWSLRNPSPRTSVSAIKTA
PAIVWRLAKKPSTAPSTSTTPTVRAKLTMQGEYPPDLFSVEERRQGWVVLHVFGMMYVFV
ALAIVCDEYFVPALGVITDKLQISEDVAGATFMAAGGSAPELFTSLIGVFISHSNVGIGT
IVGSAVFNILFVIGTCSLFSREILNLTWWPLFRDVSFYILDLIMLILFFLDSLIAWWESL
LLLLAYAFYVFTMKWNKHIEVWVKEQLSRRPVAKVMALEDLSKPGDGAIAVDELQDNKKL
KLPSLLTRGSSSTSLHNSTIRSTIYQLMLHSLDPLREAGEELGPENPRGSEEGVGRDNKQ
RKVVKVRQSGKEVRLAKEKEEESLNQGARAQPQAKAESKPEEEEPAKLPAVTVTPAPVPD
IKGDQKENPGGQEDVAEAESTGEMPGEEGETAGEGETEEKSGGETQPEGEGETETQGKGE
ECEDENEAEGKGDNEGEDEGEIHAEDGEMKGNEGETESQELSAENHGEAKNDEKGVEDGG
GSDGGDSEEEEEEEEEQEEEEEEEEQEEEEEEEEEEEEKGNEEPLSLDWPETRQKQAIYL
FLLPIVFPLWLTVPDVRRQVGETIGISEEIMGLTILAAGTSIPDLITSVIVARKGLGDMA
VSSSVGSNIFDITVGSLWIKNLTPGGVEFLPLTHADIYYMEAVEGPLEPEGFLNEITGGK
GWDRRSSYKTSSYAHCSLIIPKAAGPKDADVVYISAFLTSAPNTRCNFVSSFSVQIVRFY
Q