GENSCAN 1.0	Date run: 15-Jan-104	Time: 09:42:57

Sequence RPS27L_1 : 6021 bp : 41.74% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +   2157   2265  109  2  1   54   98    93 0.635   5.84
tattatgaaaagtactgatgaaagttattaacaggtttcgaaaaataactttactatctg
acgtgttgcttctgccgaggatgaccgttattcctgtttttgcatgtatatttcacgtat
ggttaaatgtgccagcgttgtggtttaaaactaatagtaataatatgcttctttgttcag
TTGGCTAGAGATTTACTACATCCGTCCTTGGAAGAGGAAAAGAAAAAACATAAAAAGAAA
CGCCTAGTACAAAGTCCAAATTCTTACTTTATGGATGTAAAATGTCCAG
gtaaaatttgaaatcttaattcctttactaaagaaaatttctgtagggattgctagtgtg
gtgtgtatagttaagatacattagaaccctctgttgagtagaagtgggattacagaattg
gaaatgtcagggacattttcataataaatgtactgaaaccattgtagaaacatttcgggg

 1.02 Term +   2947   3125  179  2  2  135   48    26 0.593   0.17
tattgattttacctgtttttaaaaaattttgtgtcgctgctagaaaagtttatgttacac
atgtggcttgctgtttcatagcactgaagttactgatttttttacatattaccagaaatg
tcgaacaggtgctgttttcctctgcttttcatttttaacattgcctttttttttttttag
GTTGCTACAAGATCACCACGGTTTTCAGCCATGCTCAGACAGTGGTTCTTTGTGTAGGTT
GTTCAACAGTGTTGTGCCAGCCTACAGGAGGAAAGGCCAGACTCACAGAAGGTATATCAT
TTGGCATTCTCCAACCCAGTGATGAGATTGATGATTATAAATGTCTCTATCTTCACTGA
aaagtttaaagaaatcttaatgattaccaaaataacttatctttcattgtgtgctttcag
taaagaatggcctgttcaaatggatatatttatactcttgaccttgcagtgaactccatt
gacttatttttcttagtttagaacacatttattcacttagtttgcttaacttggaataaa

Predicted peptide sequence(s):


>RPS27L_1|GENSCAN_predicted_peptide_1|95_aa
LARDLLHPSLEEEKKKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVGCSTV
LCQPTGGKARLTEGISFGILQPSDEIDDYKCLYLH