GENSCAN 1.0	Date run: 15-Jan-104	Time: 10:22:22

Sequence RPS17_1 : 6100 bp : 50.98% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1226   1492  267  1  0   98   80    51 0.419   2.33
acaccctgcccaccggaggggcgcgccaccgccgcccccgctccactccgccagggggcg
ctgtgtggctcccgagtaggctcagagcgaccgtggccgggcggaagcggctttctggcc
taagctttaacaggcttcgcctgtgcttcctgtttcctcttttaccaaggacccgccaac
ATGGTAGGTGTTTTGGCTCGAGGCCGCCATCCTCCACAATCGTCCCCCATCTGCAGCTTC
CCGCGGTCCTCAGCCCACAGAGAGGCCCTGGGCCGGGAAGGCGCAGAGCCCTGTCAGGCT
GGAGCGCAACGGGCCGGCGGCTTCCGCATTAAGCCCGGCGCCCGGCACTGTTTAGCCGGG
CCCTCTCCGGCTCAGCGCAGCCGGCGGTCCCCAACCACACCGGCCGGGGCTCGGCGCCGC
ACTCTTCCCAGAAGGTTGCGCTGGCTC
gtgagtgatcctgtcctctccacccgcagggccgcgttcgcaccaaaaccgtgaagaagg
cggcccgggtcatcatagaaaagtactacacgcgcctgggcaacgacttccacacgaaca
agcgcgtgtgcgaggagatcgccattatccccagcaaaaagctccgcaacaagatagcag

 1.02 Intr +   1522   1673  152  0  2  128   96   384 0.999  42.16
ggctggagcgcaacgggccggcggcttccgcattaagcccggcgcccggcactgtttagc
cgggccctctccggctcagcgcagccggcggtccccaaccacaccggccggggctcggcg
ccgcactcttcccagaaggttgcgctggctcgtgagtgatcctgtcctctccacccgcag
GGCCGCGTTCGCACCAAAACCGTGAAGAAGGCGGCCCGGGTCATCATAGAAAAGTACTAC
ACGCGCCTGGGCAACGACTTCCACACGAACAAGCGCGTGTGCGAGGAGATCGCCATTATC
CCCAGCAAAAAGCTCCGCAACAAGATAGCAGG
gtgagtcgggccttcctcggcctccggggctccgcgatctgtttgtgtgctctgccgccc
tccgactcgggaagagacggtgccttggtggtttcgttagcctgagactccctggtgtcc
cggagaagggctagagctctgcgtgtgcaggatttctgttgtgaacttaggcctgtgtca

 1.03 Intr +   2669   2774  106  2  1   82   82   104 0.999   9.42
gggaaggaatgctcaggccagtggaggttctatgtgtaggaggtcccaggatagtgagtc
ctcttccttctcactgtggaaaagaactaaagcgggtatttatatatgcacatgtgctca
gtaccaggtgggagttgatttgtcttctcactgttctctttggctgtgtgtgctttgtag
TTATGTCACGCATCTGATGAAGCGAATTCAGAGAGGCCCAGTAAGAGGTATCTCCATCAA
GCTGCAGGAGGAGGAGAGAGAAAGGAGAGACAATTATGTTCCTGAG
gtaaactttctggatatttgggcttctggctaatcctcaaatgataaagctatgggttct
tggcttccaaagggacctcagctgaatctgagacctttaatccatacattccataaccag
ctgtgggtgcccataggccccctaccagtttcttagcctccattctgctcttctggaacc

 1.04 Intr +   3283   3348   66  0  0  120  111    60 0.998  10.60
aaggccagaagaacaggtcatcggggtctgtaatactgtaagagactgctcaccttgtga
gaggaatgctatccttgtgcagctcctcttccccatatttaagaacctggggagaggagg
aggagaggtgagtgataatctcattgattggtattttgaccctacctcgtttccttgtag
GTCTCAGCCTTGGATCAGGAGATTATTGAAGTAGATCCTGACACTAAGGAAATGCTGAAG
CTTTTG
gtaagtgtttgctggattcctaaagtggtattttcctggtcaaaaaccatcagtaggtct
tattatccaaggtcacccagctagtaagtggcagagttgggaatcccatctaaacttgta
gccactaaactggactgctttcataaggggtgtagcggaagttgtgtgcattgagttagt

 1.05 Term +   4773   4853   81  2  0  136   38    11 0.783  -1.41
aaggaagatcactctggaaaagtgggaggcattgagaaccctgttggctcttaaagggtc
cttcaggtcgcctctggacccccttgagagtgctgtggctctaggggcctgtgttttctt
ctggggtccactcacagatctcaccagtaactgctcactgaatccattttctcgttccag
GACTTCGGCAGTCTGTCCAACCTTCAGGTCACTCAGCCTACAGTTGGGATGAATTTCAAA
ACGCCTCGGGGACCTGTTTGA
attttttctgtagtgctgtattattttcaataaatctgggacaacagccttgcctgtgtc
atctttgcagttgtgtgtgggtagaggaaaggcaggagctctcgaggcaacagatcagct
ggcacttgtctgggattcaggtgctgctgcatctggtttatggggagtgggttcaccaga

Predicted peptide sequence(s):


>RPS17_1|GENSCAN_predicted_peptide_1|223_aa
MVGVLARGRHPPQSSPICSFPRSSAHREALGREGAEPCQAGAQRAGGFRIKPGARHCLAG
PSPAQRSRRSPTTPAGARRRTLPRRLRWLGRVRTKTVKKAARVIIEKYYTRLGNDFHTNK
RVCEEIAIIPSKKLRNKIAGYVTHLMKRIQRGPVRGISIKLQEEERERRDNYVPEVSALD
QEIIEVDPDTKEMLKLLDFGSLSNLQVTQPTVGMNFKTPRGPV