GENSCAN 1.0	Date run: 15-Jan-104	Time: 10:34:03

Sequence MKRN3_1 : 5171 bp : 43.32% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Sngl +   1310   2833 1524  1  0   97   39   786 0.314  69.79
ctgtgcccggaagtaggtaggaacacacagtcagagggacccaaaagcaggggggaagga
aaaagagatgcacacttcccccagagaagcctccgagcgcggccgccattccgggcctca
agcccataaagaaaaaataccggagaggttctggcaccatttcggggtgccaaagcagcc
ATGGAAGAGCCTGCAGCTCCCTCAGAAGCCCACGAGGCAGCCGGGGCCCAGGCAGGTGCT
GAGGCAGCAAGGGAGGGTGTGTCTGGGCCGGACCTTCCCGTCTGTGAGCCCTCCGGGGAA
TCTGCTGCTCCAGATTCAGCCCTGCCACATGCGGCAAGGGGCTGGGCCCCCTTCCCTGTA
GCTCCAGTCCCTGCCCACCTCCGCAGAGGAGGCCTGAGGCCTGCCCCAGCCTCAGGAGGA
GGAGCCTGGCCCAGTCCGTTGCCAAGCCGAAGCAGCGGCATTTGGACAAAGCAGATCATC
TGCAGGTATTATATACATGGGCAGTGCAAGGAGGGGGAGAACTGTCGCTATTCGCACGAC
CTTTCTGGTCGGAAGATGGCCACTGAGGGTGGCGTTTCGCCGCCTGGGGCCTCTGCAGGT
GGAGGCCCTAGCACGGCTGCGCACATCGAGCCCCCGACTCAGGAAGTGGCGGAAGCCCCC
CCGGCTGCATCCTCCCTTTCCTTGCCTGTGATTGGCTCGGCTGCTGAAAGGGGTTTCTTT
GAAGCCGAGAGAGACAATGCAGACCGTGGAGCTGCTGGAGGAGCAGGTGTAGAAAGCTGG
GCGGATGCCATTGAGTTTGTTCCAGGGCAGCCCTACCGGGGCCGCTGGGTTGCATCTGCC
CCCGAGGCTCCTCTACAGAGCTCAGAGACTGAGAGGAAGCAGATGGCTGTGGGCAGTGGG
TTGCGGTTTTGCTATTATGCTTCCAGGGGAGTTTGCTTTCGTGGGGAGAGCTGTATGTAC
CTCCATGGAGACATATGCGACATGTGTGGGCTGCAGACCTTGCACCCCATGGATGCTGCC
CAGAGGGAAGAACATATGAGGGCCTGCATTGAAGCACACGAGAAAGATATGGAACTCTCG
TTTGCTGTGCAGCGTGGTATGGACAAGGTGTGTGGCATCTGCATGGAGGTTGTCTATGAG
AAGGCCAACCCCAATGACCGCCGCTTTGGCATTCTTTCCAATTGCAACCATTCCTTCTGT
ATTAGGTGTATCCGCAGGTGGAGAAGTGCCAGACAGTTTGAGAACAGGATCGTCAAGTCT
TGCCCACAGTGCAGGGTCACCTCTGAATTGGTCATTCCCAGTGAGTTCTGGGTGGAGGAG
GAGGAAGAGAAGCAGAAACTTATTCAGCAATACAAGGAGGCAATGAGCAACAAGGCCTGC
AGGTATTTTGCGGAAGGCAGGGGTAACTGCCCATTTGGAGACACATGCTTTTACAAGCAT
GAATACCCTGAGGGCTGGGGAGATGAGCCTCCTGGGCCAGGTGGTGGGTCATTCAGCGCA
TACTGGCATCAACTTGTGGAGCCTGTGCGAATGGGAGAGGGCAACATGCTCTATAAAAGC
ATTAAGAAGGAGCTTGTCGTGCTTCGGCTGGCCAGTCTGTTGTTTAAGCGGTTTCTTTCA
CTGAGAGATGAGTTACCCTTCTCTGAGGACCAGTGGGACTTGCTTCATTATGAGCTGGAA
GAATATTTCAATTTGATTCTGTAG
catcgtgctgtggcatgtggtctagtctgctgaggttctgtcgtctgctattgcctgttt
tccctgtgttgacactcttactgctttcaggggctgttgaggcagtgcttctgttttctt
gtctattctgcatatctttccccctaggattatggtgattatctgtgttaaaaaataagt

Predicted peptide sequence(s):


>MKRN3_1|GENSCAN_predicted_peptide_1|507_aa
MEEPAAPSEAHEAAGAQAGAEAAREGVSGPDLPVCEPSGESAAPDSALPHAARGWAPFPV
APVPAHLRRGGLRPAPASGGGAWPSPLPSRSSGIWTKQIICRYYIHGQCKEGENCRYSHD
LSGRKMATEGGVSPPGASAGGGPSTAAHIEPPTQEVAEAPPAASSLSLPVIGSAAERGFF
EAERDNADRGAAGGAGVESWADAIEFVPGQPYRGRWVASAPEAPLQSSETERKQMAVGSG
LRFCYYASRGVCFRGESCMYLHGDICDMCGLQTLHPMDAAQREEHMRACIEAHEKDMELS
FAVQRGMDKVCGICMEVVYEKANPNDRRFGILSNCNHSFCIRCIRRWRSARQFENRIVKS
CPQCRVTSELVIPSEFWVEEEEEKQKLIQQYKEAMSNKACRYFAEGRGNCPFGDTCFYKH
EYPEGWGDEPPGPGGGSFSAYWHQLVEPVRMGEGNMLYKSIKKELVVLRLASLLFKRFLS
LRDELPFSEDQWDLLHYELEEYFNLIL