GENSCAN 1.0	Date run: 15-Jan-104	Time: 10:38:48

Sequence MEF2A_1 : 117729 bp : 36.65% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +  35864  35917   54  1  0   72   99    49 0.820   5.73
tacagattttaaatcttctaatttgtgttttcttttagatcttgtagaaaatttcagctg
tagcccttggactagaagctgaaataacagaagctgtgtacgatgcattagggtattgaa
gaaaattaacttttgaattaaatatttggaatataaggaaataaggaaagttgactgaaa
ATGGGGCGGAAGAAAATACAAATCACACGCATAATGGATGAAAGGAACCGACAG
gtaaatgaaaattttaatttatttaattgatatgaatattcttttaaaaaaagaacatag
gacagaatggttgggtttttcttaaacttaattttaagtctaaatatttttagttacaga
ctaaatgaaaaattctaacaatcataaaattgtatcttttcatcatctgctttaaagaga

 1.02 Intr +  48305  48508  204  1  0   92   77   145 0.907  12.27
caaaacaaatgtaggactgtagcacaacaggagagggaaggctcatatggaggacaaagc
tgggaaccttttccatctttgaaatctggctcagtattaagaagaagattcatcttcaga
tagcccatattcaagtactactaatgcttttaataaaaatataccttttttattgtttag
GTCACTTTTACAAAGAGAAAGTTTGGATTAATGAAGAAAGCCTATGAACTTAGTGTGCTC
TGTGACTGTGAAATAGCACTCATCATTTTCAACAGCTCTAACAAACTGTTTCAATATGCT
AGCACTGATATGGACAAAGTTCTTCTCAAGTATACAGAATATAATGAACCTCATGAAAGC
AGAACCAACTCGGATATTGTTGAG
gtaacacatatctagtaatacgtgaattgcaagtaatactgaaatattttgtttaatagc
attaactgtcagaatgacttgtacatctaaaacataaattaggtgtatatgtatcttttc
tctaaatcatttcttagaagagtgattgctgtatggcgactcacttgtgttataaacata

 1.03 Intr +  53038  53073   36  0  0   94  103     6 0.527   0.24
ttaaaaaaaaaattcttctcgcagtatctcatttaagcttcatattcaaggtaagctttt
tcagaagcaaaaattgggatgcacattaaaatgacttgcccagagtcatgtagcaatgta
gtggcagaaccaggattaggacccaggtctgtgacattaacctttccccttgctccttag
TTCACTGCATCCAGGGGAGCTCTGGAGCATTTTACC
gtaagtagataagattttatacatacaccaatcatgtacgatctatagcagtcacgaata
agttttcctcagtaatgaacagaaaactagtgaggataatagcagtaagaatgataggta
ttattaagcacttaacatggtctagtaaagacttcatttgaattatcttattgaatcctt

 1.04 Intr +  54318  54348   31  2  1  100   72    70 0.440   3.39
tttctccccatgttatagacgaggaatggaacagacagggagtatttaagaggcttgcct
aatgttttacagggctgcagtggagcatcagggaaagggaaaaaataatgagacatctga
agacaagacaaagctttcctccacctccagtcccctgccctgctcttttattcctaacag
AGCCTGAAGCAGCAGGATGATGATTCACAGG
gtgaggcacatagtcctcatggctctcctccgcttcccacatgtcactgcaccatcgcct
cacacagcagtcaccatagctcttgtaatttcagttttactacttttattttgctgtgca
tgtgaatattatttaatcatacaattattggttttcatttatgtgctttgtataagggac

 1.05 Intr +  63594  63704  111  1  0    2  100    81 0.178   0.13
ttatggatttattaaagcatctagcattacttatactaatacagagattaaatctagtga
tatgtagaagagataatatattatgactaagttgaatgtatcctagtagagttataccat
attcatagatcagaagtctcaaattatatatatctgtgccacataagataatctctgtag
AGTTGATGAAATATCAATCAGAATCCCAAGAAATACTTTTTGAAAGAACTTCAACAACTG
ATTCTAAAGTTCACAGAGAAAATAGAACAGAAGACACTGAAGAAGAACAAG
gtgagagggtttgcactgcaatatattgagactaattttaaagctataataatgaacata
cagtggcagtggcacaaataccaaatgccaaacgtaccaatggaataatagctcagaaac
aggaccatgcatatttagatacttaatatatgatagagtggcagaacaaactccttaagc

 1.06 Intr +  66606  66716  111  1  0   86  116     9 0.829   2.93
ttttaaatgagttgccctgcctaattagtaattcattttgaaataaatttttgtaagttt
attatgtaaaagaaaacctcaacatacttaaaaaaaagtttatacagtattgtttttgtc
ctctcaagtatcttttttctttcttttttcacctcttcccttaatcctttccatctctag
TTTCACCAAGAGGTTTAGTATATAAACCAGAAAATGAGAGGCAGATGTACAGGGTCAGCC
AAGTGGTAACATATACCCAGAATTCTGTAAATGTTTCCTTGAATTTGAAAG
gtaaggttgtcagtactctataagtagaatgataggacgtatgactttaaagatttttgt
tggggtagataccattgtttcaatcagttatctttgaccaacaacagtaattaatcatca
cttctaggtttgagactctttctggattctatgttgtagaggtactagccagacttattt

 1.07 Intr +  70565  70590   26  0  2   95   82    23 0.910  -0.77
aaatgtataagcccaccaagaaggccaaatgaatttgcttcataaatacaaaaactggct
cttccacagttgagagaggaagtcagttgaacttccaccaggcgggatttgtttgcacat
ctacaaacacaaattatttgcattactctcacttttctacacattatcttctgtttacag
AGTTGGAAAATAGCTCAGAAACCAAG
gtacaaaccccctagaatcagataacttggcatgtgctctaaacaatacagagttttaag
agatatttagttttttgggtttcatttaaaaatatttcagtatccttacataactagcgt
tgaaaggtaaatattagctaagtttattacttaaatcctgcgttttgtaccataaatgac

 1.08 Intr +  74067  74198  132  2  0   72   95   160 0.999  15.02
tacttatatttaatgtttatcttatttgaagaagtaagtacatttgtgatcatttagaaa
ccgtttcagtggctcttgtataattcagttcattccgtctgtgctctcttaataaatttt
acagaaaaactcatggcaagttagcattatttgtgtgtgaattttccaattgtatttcag
ACTTTAAGAAAGAAAGGCCTTAATGGTTGTGAGAGCCCTGATGCTGACGATTACTTTGAG
CACAGTCCACTCTCGGAGGACAGATTCAGCAAACTAAATGAAGATAGTGATTTTATTTTC
AAACGAGGCCCT
gtaagtacttttactttacctctactttttatttgttgatcctttttgttaacttcatta
tttaggctctgaacaagaaggaacacagagggtgcgacagcccagaccctgatacttcat
atgtgctaactccacatacagaagaaaaatataaaaaaattaatgaggaatttgataata

 1.09 Intr +  74264  74401  138  1  0   53   73    95 0.915   4.24
ccttaatggttgtgagagccctgatgctgacgattactttgagcacagtccactctcgga
ggacagattcagcaaactaaatgaagatagtgattttattttcaaacgaggccctgtaag
tacttttactttacctctactttttatttgttgatcctttttgttaacttcattatttag
GCTCTGAACAAGAAGGAACACAGAGGGTGCGACAGCCCAGACCCTGATACTTCATATGTG
CTAACTCCACATACAGAAGAAAAATATAAAAAAATTAATGAGGAATTTGATAATATGATG
CGGAATCATAAAATCGCA
gtgagtactaaagtatggtttgtgcttttatcttgtgcatgaagagattgaccaaacatc
ttgttgcttatttttatagtgggtgatgacaacaataagtagaagggaagaaatgcattt
tattagtattttttataaaacttcaaaataaaattgctgaaatcttatacatgttcagta

 1.10 Intr +  77137  77356  220  0  1   96   91   160 0.841  14.05
tcatattcatgttcaaacataattctaaagaaaatagctttaatctgtaaattggttaag
aacctatccctatcctctacttttagtaacttgagttaccttgccaaattaaagttcaaa
agttactttgtagatgaatacgaaaccaacagttttttccttctttttctttatttacag
CCTGGTCTGCCACCTCAGAACTTTTCAATGTCTGTCACAGTTCCAGTGACCAGCCCCAAT
GCTTTGTCCTACACTAACCCAGGGAGTTCACTGGTGTCCCCATCTTTGGCAGCCAGCTCA
ACGTTAACAGATTCAAGCATGCTCTCTCCACCTCAAACCACATTACATAGAAATGTGTCT
CCTGGAGCTCCTCAGAGACCACCAAGTACTGGCAATGCAG
gtatgtagtgatacctattatgctggttctttaataaagagggtgaaaaaattcattgct
aacataagcagtttcttattttgctattcttttattgctttgatgagcaagaatcactga
tacataattggcctcattttaaagtatttttttgaaaatcaattgtgggtgtagcattgt

 1.11 Intr +  78143  78202   60  0  0   79   92    68 0.931   4.09
gatataataactacatcagattacatgttaatgccaacttcagactgagctagtttttat
ttttgtgtctttttaggattagagtgagagttatctctattcagttcacgttcagttagg
taaagagagctaattcatattcattctctgccctctgtcttctctccgtaacgttgttag
GTGGGATGTTGAGCACTACAGACCTCACAGTGCCAAATGGAGCTGGAAGCAGTCCAGTGG

gtgagtgaattcctactcttctgttttgtaggtatctatcctatatgagatcaaaggaat
gttgttcctgaaataaagctttctgggaaatttccttctgaagggtactttcactaatac
atcaagataatttcttaaggggagactttctctaacttccctgcttaccaaagttagact

 1.12 Intr +  80360  80542  183  0  0   -4   89   108 0.560   0.54
agaacttaacagatgggcttaaaaacagattggacaaagcaaatacaagaattaagaaac
taaaagataagatagaagaaaattatccagaattttggagacacaaagggatggaaaatt
aaaaagaagacccagagcatgcaataaaaaggactagcatacgttaaattgaagtcccag
GAAGCAAAGTCAGAGAAAATTGGGCAGAAGCAGTATTTGAAGAGATAATCACTGAGAATT
TTCCAAAACTAACAACAACAAAAAAGCCACAAATTGGGAAGGCCTATAAAACTCAACGTG
GAATACAGATAATGCTGTGCTTTATGAGAAATTTAAACCTTTATGAACAAAAGACTGGAG
ATG
gtgagctaaacctccttctcaggaagtcagaaaaggacagcaaattaaacataaagtagg
tagaaccaaataacaaagatacaagcattgaaatagaaaatagaaaattttctatttcag
gcatggtgaaacagatgatctcatacgtgcttttgtggtattgtaaatcagtaacaatct

 1.13 Intr +  92985  93172  188  1  2  115   94   145 0.989  16.29
aagtattccaaaatcagaaacacttctggtcccaagcatttcggacaagggatactcaaa
cctgtagtgagttttgttataaaatttatttgcaactcagactggggaaaacttgatttg
tttgtgccaaagtattttaataactcttctcactttattgaatgatatttttccccccag
GGAATGGATTTGTAAACTCAAGAGCTTCTCCAAATTTGATTGGAGCTACTGGTGCAAATA
GCTTAGGCAAAGTCATGCCTACAAAGTCTCCCCCTCCACCAGGTGGTGGTAATCTTGGAA
TGAACAGTAGGAAACCAGATCTTCGAGTTGTCATCCCCCCTTCAAGCAAGGGCATGATGC
CTCCACTA
gtaagttgaacctttcttcaacttcattctttaaaacacatattttatacatagtcaatc
tgtagcttcctttggaattttctgtgccaccgtagaatctacacctattcctaataaata
tttccattcaaaattagtatttgaagagacaagtctatttcaaatacacaaaaatcagat

 1.14 Intr + 109473 109599  127  2  1   71   93   102 0.695   8.33
ggacccttcaaattaaatatttagttattctcactagtatttttgaagttttcacatcat
cagtgcttcagaaaatgacattcatatgaaactgtgaaaaatgtcacttaaattgaaagt
gatttttaagtcaacataaataccacatcagaacacattttctcttttttgatctcacag
AATACCCAGAGGATCAGTAGTTCTCAAGCCACTCAACCTCTTGCTACCCCAGTCGTGTCT
GTGACAACCCCAAGCTTGCCTCCGCAAGGACTTGTGTACTCAGCAATGCCGACTGCCTAC
AACACTG
gtgagcctgctctggtgccttccgtaggttttaccgctctctgttttgtgatcaacgtgt
gcttctgtgattttttttaagtatatttattgaaataaactatttccagttttttagatt
taaattaggatgtatttttcaatgtgctagccttgaaaaaattacaaacaaaatggatag

 1.15 Intr + 113378 113504  127  0  1   87   56    82 0.760   3.72
gctggtctcaaactcctgacctcaagtgatccgcccatcttggcctcccaaagtgctggg
attactggcatgagccagcatggctggcctcaatgtaggaacttttgcagtagctacgta
aaaaatagattccgtatggaccttccatcatatgcagagccctcttgtcttcctttgtag
ATTATTCACTGACCAGCGCTGACCTGTCAGCCCTTCAAGGCTTCAACTCGCCAGGAATGC
TGTCGCTGGGACAGGTGTCGGCCTGGCAGCAGCACCACCTAGGACAAGCAGCCCTCAGCT
CTCTTGT
gtgagtaactagaagttttccctgcatctttactcctggcctacacactctcttttccta
tcagtgacagccttttgctctgttgagtttcgtgtgaggaatcctgtaatgattcctttt
caggtagatacaagtgtcgggagaaaatattttcttacatggctctagacagtagcttgg

 1.16 Term + 115134 115515  382  0  1  131   48   551 0.999  48.73
ggaagatgggatttccttttgtgccaagcactgaaggaaacgacccaaaccagtcttggg
gaactctgataagatttcagactctgggcccttttccatcaggcagtgtctctactgtat
catcccagttttgcagaggtacttgcaagccatctgacctctctcttttttttccttcag
TGCTGGAGGGCAGTTATCTCAGGGTTCCAATTTATCCATTAATACCAACCAAAACATCAG
CATCAAGTCCGAACCGATTTCACCTCCTCGGGATCGTATGACCCCATCGGGCTTCCAGCA
GCAGCAGCAGCAGCAGCAGCAGCAGCAGCCGCCGCCACCACCGCAGCCCCAGCCACAACC
CCCGCAGCCCCAGCCCCGACAGGAAATGGGGCGCTCCCCTGTGGACAGTCTGAGCAGCTC
TAGTAGCTCCTATGATGGCAGTGATCGGGAGGATCCACGGGGCGACTTCCATTCTCCAAT
TGTGCTTGGCCGACCCCCAAACACTGAGGACAGAGAAAGCCCTTCTGTAAAGCGAATGAG
GATGGACGCGTGGGTGACCTAA
ggcttccaagctgatgtttgtacttttgtgttactgcagtgacctgccctacatatctaa
atcggtaaataaggacatgagttaaatatatttatatgtacatacatatatatatccctt
tacatatatatgtatgtgggtgtgagtgtgtatgtgtgggtgtgtgttacatacacagaa

Predicted peptide sequence(s):


>MEF2A_1|GENSCAN_predicted_peptide_1|709_aa
MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSSNKLFQYAST
DMDKVLLKYTEYNEPHESRTNSDIVEFTASRGALEHFTSLKQQDDDSQELMKYQSESQEI
LFERTSTTDSKVHRENRTEDTEEEQVSPRGLVYKPENERQMYRVSQVVTYTQNSVNVSLN
LKELENSSETKTLRKKGLNGCESPDADDYFEHSPLSEDRFSKLNEDSDFIFKRGPALNKK
EHRGCDSPDPDTSYVLTPHTEEKYKKINEEFDNMMRNHKIAPGLPPQNFSMSVTVPVTSP
NALSYTNPGSSLVSPSLAASSTLTDSSMLSPPQTTLHRNVSPGAPQRPPSTGNAGGMLST
TDLTVPNGAGSSPVGSKVRENWAEAVFEEIITENFPKLTTTKKPQIGKAYKTQRGIQIML
CFMRNLNLYEQKTGDGNGFVNSRASPNLIGATGANSLGKVMPTKSPPPPGGGNLGMNSRK
PDLRVVIPPSSKGMMPPLNTQRISSSQATQPLATPVVSVTTPSLPPQGLVYSAMPTAYNT
DYSLTSADLSALQGFNSPGMLSLGQVSAWQQHHLGQAALSSLVAGGQLSQGSNLSINTNQ
NISIKSEPISPPRDRMTPSGFQQQQQQQQQQQPPPPPQPQPQPPQPQPRQEMGRSPVDSL
SSSSSSYDGSDREDPRGDFHSPIVLGRPPNTEDRESPSVKRMRMDAWVT