GENSCAN 1.0	Date run: 15-Jan-104	Time: 10:15:51

Sequence IDH3A_1 : 23564 bp : 42.89% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.04 PlyA -    205    200    6                              -1.95
 1.03 Term -   1114    933  182  2  2   91   45    69 0.450  -0.31
 1.02 Intr -   2067   1941  127  0  1   91   93   124 0.572  12.53
 1.01 Init -   3127   3002  126  1  0  110   50    93 0.805   7.91
 1.00 Prom -   3610   3571   40                              -5.45

 2.01 Init +   9354   9455  102  2  0    6  106    95 0.603   3.39
agtaggattgcagagtctctcctctgttgattcctgcctcccctttgatgacccccgggg
aggtatgtttgttttcttaacagcatttgaatcttcctgagacatctcataaagtggatt
tctctgtcaaaatattcttttttaagccttcaaaaacaaaaattcttactgtcttctttg
ATGATTTCTTATGTTCAGGTTCAGACAGTAACTTTAATTCCAGGAGATGGTATTGGCCCA
GAAATTTCAGCTGCAGTTATGAAGATTTTTGATGCTGCCAAA
gtaagtgggcttaaaaaatacatttaatgatgactcactgaaaagttttcttagccagtt
ggattctgtgaacttttaggatgcattgtacccatttctatgaaatttagtcaggtctgt
tgttaatctccaccgattgtcactttaacagtgtgtgtctcagtgtttgctactgccatt

 2.02 Intr +  11916  12030  115  2  1   65   64   133 0.891   7.70
tggaacctgggaggcggaggttatagtgagccaagattgtgccgctgcactctagcctag
gcgacagagcgggactctatctcaaaaacgaagttgaaaaagtttgttcatcattgcagt
atgaatgccagtttcctttaagtctctccagctcactgtgctctgtgatgtggcatctag
GCACCTATTCAGTGGGAGGAGCGGAACGTCACTGCCATTCAAGGACCTGGAGGAAAGTGG
ATGATCCCTTCAGAGGCTAAAGAGTCCATGGATAAGAACAAGATGGGCTTGAAAG
gtagcactgaagtagagacgggggtttttacagatttccgctacaggggttacttagttt
tgaaaatttatgcatttaaactgaataaggcctggccatctgtgaaggtaacgccattct
tttatgaagtaactactcatagtaagatgttttattcatttgggacatttttttccccca

 2.03 Intr +  13405  13592  188  2  2   75   68   197 0.995  14.89
gaaacgcagttaatgttccagaaagctcccgtgaggaagtgttcctccttcatttgaatc
tcaggtagagagtgaactagaggcagaacacatttcacaaggtagccgaggtgggttagt
aggtcacacgtgagaccagaattccttctagtgtcatctgggttttcttctgtataacag
GCCCTTTGAAGACCCCAATAGCAGCCGGTCACCCATCTATGAATTTACTGCTGCGCAAAA
CATTTGACCTTTACGCGAATGTCCGACCATGTGTCTCTATCGAAGGCTATAAAACCCCTT
ACACCGATGTAAATATTGTGACCATTCGAGAGAACACAGAAGGAGAATACAGTGGAATTG
AGCATGTG
gtatgttcactccagattcttttttattcctgcttggactgctttctgtgcatctgggac
cccagagacagatctgctttatctctgtgaggagttgtgggtgtttgtcttggtgctggg
tgtctggctgacagtactcaaacaaatgtaaggcatggtggttcgcgtcacaagcttggg

 2.04 Intr +  14058  14191  134  2  2   73   58   231 0.981  17.12
acttacctcttagggctggagttaacatgaaccccattgtcgtagcagtgtgtgtgatta
gtcatgctagctggcactgtgcaggcctgccacaaatgttactgtctactccccaccctc
tgtctcccactgcgttgctgtcacactctttccagcaaggtgggacttcctgtcttgcag
ATTGTTGATGGAGTCGTGCAGAGTATCAAGCTCATCACCGAGGGGGCGAGCAAGCGCATT
GCTGAGTTTGCCTTTGAGTATGCCCGGAACAACCACCGGAGCAACGTCACGGCGGTGCAC
AAAGCCAACATCAT
gtgagctccttgcgggggccggcaccccatcttgctttgttgtgggagagcagtgacagg
gcttccctttctcctcttcagcttgttccttgattcctaatatctttgaaaaagaacttt
gtaacaatccaaagatacggcatctctcttctgtcggagtctcctcttttctcctctgtt

 2.05 Intr +  16816  16900   85  1  1   63   99    95 0.990   7.00
gacacagtaagatgctcgaggctcatctgtattttcctaacctttgccctggaatcagcc
atttatccaaggaatgctacttccttttagtggagaatgataattaaaaactaaaatctg
ggtgctaggtgagatgttttatttttaaaaacattctttgaaatgcttttcttccgctag
TGACTTGTGTGCAGGATTGATCGGAGGTCTCGGTGTGACACCAAGTGGCAACATTGGAGC
CAATGGGGTTGCAATTTTTGAGTCG
gtaaggaccctgacacctgaaacagaactcaggtcagaacagcgtgtgaactcaggagga
gttatctgtataagtatgctttaactccagtttttcaaattgtcaaaacaaaatgatgct
ttttttttttctcgagacggagtctcgctctgtcacccacgctggagtacagtggtgcga

 2.06 Intr +  17974  18126  153  0  0   83   87   149 0.986  13.65
tgagctatcacgcccaacccagactttatttcttcagtccatatcagatgaattgcacgc
agtagctttcagtgcatattttgtattgctgaggaaagatggttaagactccagcttccc
cagaagaggactgttagtttttgtctctcccttgatgatgctacttttcccgatgtgtag
GTTCATGGGACGGCTCCAGACATTGCAGGCAAGGACATGGCGAATCCCACAGCCCTCCTG
CTCAGTGCCGTGATGATGCTGCGCCACATGGGACTTTTTGACCATGCTGCAAGAATTGAG
GCTGCGTGTTTTGCTACAATTAAGGACGGAAAG
gtaacaggaatcttgatttacttgtgctgggtaaaatgcattgcttccatgtgttttatc
tgagtgaaagggacagtgacagataatagttctcaggcgggcccaagcatttgatgttga
acaaggattcttaacgtgggtcccagattgaacagggtatgtgtgcacatgtgtgcattt

 2.07 Term +  22559  22648   90  1  0  103   48    71 0.633   1.34
ctctacctgtttcctgttcagatgccttcggtcattttggctcagcttgctactgagaat
ggctgcttcccgtattcagaatggaagtggggtggtctggtggcgacaggctaacgtaga
gctggctgcttttatgagaatgcgccacttgaccccatcctgcacctttgtttattccag
GGCACTAATGGTCACTCGCATGCCCGCTGTGCACAGTCCTGTGAGTTAAATGCCCACTAC
TCTCTGCACTGGTCCCACCTGCTCAATTGA
caaaaaaaatcaggtccttgttgacagttctgttaaaaggtttaatattcaaattataca
ttaaatagaatcaaacaggcagcagcagttttattaagcatcaagtcagttggcatgtgg
gtggcggagtgcctggtaatggaataatagggtcggcgatgcccgccaagattccagagt

 3.02 PlyA -  22743  22738    6                               1.05
 3.01 Term -  23353  23268   86  2  2  149   37    67 0.519   4.54

Predicted peptide sequence(s):


>IDH3A_1|GENSCAN_predicted_peptide_1|144_aa
MPGHNLKWKLNRGTVLIETGIQLSTSTILGSASEPPSAPIPKAQVSSTEKLRNCIDDLKP
FPALASELSRRAKALQIAGFPPMKDRLRIASRSLAAPPLDIPLANRRARLSVTGLAERQA
NPETEGPASPGKLLPPLPGSLTRC

>IDH3A_1|GENSCAN_predicted_peptide_2|288_aa
MISYVQVQTVTLIPGDGIGPEISAAVMKIFDAAKAPIQWEERNVTAIQGPGGKWMIPSEA
KESMDKNKMGLKGPLKTPIAAGHPSMNLLLRKTFDLYANVRPCVSIEGYKTPYTDVNIVT
IRENTEGEYSGIEHVIVDGVVQSIKLITEGASKRIAEFAFEYARNNHRSNVTAVHKANII
DLCAGLIGGLGVTPSGNIGANGVAIFESVHGTAPDIAGKDMANPTALLLSAVMMLRHMGL
FDHAARIEAACFATIKDGKGTNGHSHARCAQSCELNAHYSLHWSHLLN

>IDH3A_1|GENSCAN_predicted_peptide_3|28_aa
XPTMKLKRLTVLEKYKGIIDSFYQEQKM