GENSCAN 1.0	Date run: 15-Jan-104	Time: 10:25:41

Sequence HAPLN3_1 : 20651 bp : 53.00% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   9442   9565  124  0  1   77  102   319 0.998  30.49
agcgtctggcacgtaggcggcaggtgtcccgcagtgagctgttgagcaagcgagtgagtg
gtgttggagcagaggggatgtgggccctggaagccaggcttttctaattgccttgttttc
ctccccttcccagtttgccctggggccccagcctggcccgggtcaccctggcatgaggag
ATGGGCCTGTTGCTCCTGGTCCCGTTGCTCCTGCTGCCCGGCTCCTACGGACTGCCCTTC
TACAACGGCTTCTACTACTCCAACAGCGCCAACGACCAGAACCTAGGCAACGGTCATGGC
AAAG
gtaggcgacctcctgcacccggctctttgctcccctgggtgacctagacctccttggctc
ttgctgtgatctgagggttccaggctgggacagggacagcagccctgttccagcagggcc
cttgtagtgggccagcttgcttctcagacaggggaaggggtgagttcattttcctgtgtt

 1.02 Intr +  14646  14813  168  1  0   89   23    66 0.524   0.63
tgtttagctcatgattctgtgggtcagcattttggagtgggctccatttcttcaggtctt
gcggttgggtcttgcagatgtgcctgcccatggtgggcaggtcagctgggggctggttgc
tgtaggatggcctcagctggggcgccctgtctctgttctgtgtattctctcatcctctag
CAGGCAAGCCTGGCCATGTGCTCATGGTGGCTGGCAAAGTCCTAAAAAAAGAGTGGAAGC
AGCAAGGCCCCCTGGGACCTATGCTCAGAGCAGGCATGATGGATAACAGTCACTTCCAAG
GCATTCAGTTGGTCAAGCAAGTGGCAAGGCCAGCACAGATTCAAGGGG
gtgggggaataactgtcatctcttgatggaaggagatgcaaagtcacattgcagagcatg
tggatacagggaggggtggagcatggtggccatttttgcaatctgagcctgtaggagccg
tggatgagggtgtgcggtggcccttgcaggggtacagatgtgcttcagcaggtctcatct

 1.03 Intr +  15015  15383  369  1  0  101   64   806 0.998  75.14
cttgatggaaggagatgcaaagtcacattgcagagcatgtggatacagggaggggtggag
catggtggccatttttgcaatctgagcctgtaggagccgtggatgagggtgtgcggtggc
ccttgcaggggtacagatgtgcttcagcaggtctcatctgcaccctgtctctcccccaag
ACCTCCTTAATGGAGTGAAGCTGGTGGTGGAGACACCCGAGGAGACCCTGTTCACCTACC
AAGGGGCCAGTGTGATCCTGCCCTGCCGCTACCGCTACGAGCCGGCCCTGGTCTCCCCGC
GGCGTGTGCGTGTCAAATGGTGGAAGCTGTCGGAGAACGGGGCCCCAGAGAAGGACGTGC
TGGTGGCCATCGGGCTGAGGCACCGCTCCTTTGGGGACTACCAAGGCCGCGTGCACCTGC
GGCAGGACAAAGAGCATGACGTCTCGCTGGAGATCCAGGATCTGCGGCTGGAGGACTATG
GGCGTTACCGCTGTGAGGTCATTGACGGGCTGGAGGATGAAAGCGGTCTGGTGGAGCTGG
AGCTGCGGG
gtgagatgctaacggggactgggtgacactgggacctgagagcagaggggagaggaccag
agaaaacatccagacctctgtgctttagacatttaaaagtacttaattctcaaaacaacc
cacatggaagctactgttgtgacccccattttacaggtgagaaaactgaggcacagagag

 1.04 Intr +  17471  17773  303  0  0  160   96   420 0.995  47.11
agtcccaggagagaggcggcaacggacaggaggtcagaggtttgctgagtttttctgagg
gatggtgtatgtgtgtgtgttgcaggcagcacatgtcccagtgaaggtgggaggagagcg
gggtgtccagccagctgggcccctggccaccccctaagctcctctttccttcccctgcag
GTGTGGTCTTTCCTTACCAGTCCCCCAACGGGCGCTACCAGTTCAACTTCCACGAGGGCC
AGCAGGTCTGTGCAGAGCAGGCTGCGGTGGTGGCCTCCTTTGAGCAGCTCTTCCGGGCCT
GGGAGGAGGGCCTGGACTGGTGCAACGCGGGCTGGCTGCAGGATGCCACGGTGCAGTACC
CCATCATGTTGCCCCGGCAGCCCTGCGGTGGCCCGGGCCTGGCACCTGGCGTGCGAAGCT
ACGGCCCCCGCCACCGCCGCCTGCACCGCTATGATGTATTCTGCTTCGCTACTGCCCTCA
AGG
gtgagtggaatagccaagcgcgggcctgtgggtttggtggccacctgggacctgtgagag
ggcagcttctggggagctctggccccctctgctggctctgctggtactgccacctggagg
ccaagagcaccagccaccctagaagcagcatctggttgagttttgagtgctttgctgctg

 1.05 Term +  18484  18770  287  2  2   98   48   498 0.996  42.71
ggcaggtgggacagagctctctgggacagggtgaagattagaaagtgttctctgcagatg
cctgcagtatggtagctccctgggctcagacgggtctttggggctggcatctctgcagac
cccgctgtgctctctggctgccccctgcgctgtacggcactcacgccccctttcccccag
GGCGGGTGTACTACCTGGAGCACCCTGAGAAGCTGACGCTGACAGAGGCAAGGGAGGCCT
GCCAGGAAGATGATGCCACGATCGCCAAGGTGGGACAGCTCTTTGCCGCCTGGAAGTTCC
ATGGCCTGGACCGCTGCGACGCTGGCTGGCTGGCAGATGGTAGCGTCCGCTACCCTGTGG
TTCACCCGCATCCTAACTGTGGGCCCCCAGAGCCTGGGGTCCGAAGCTTTGGCTTCCCCG
ACCCGCAGAGCCGCTTGTACGGTGTTTACTGCTACCGCCAGCACTAG
gacctggggccctcccctgccgcattccctcactggctgtgtatttattgagtggttcgt
tttcccttgtgggttggagccattttaactgtttttatacttctcaatttaaattttctt
taaacatttttttactattttttgtaaagcaaacagaacccaatgcctccctttgctcct

Predicted peptide sequence(s):


>HAPLN3_1|GENSCAN_predicted_peptide_1|416_aa
MGLLLLVPLLLLPGSYGLPFYNGFYYSNSANDQNLGNGHGKAGKPGHVLMVAGKVLKKEW
KQQGPLGPMLRAGMMDNSHFQGIQLVKQVARPAQIQGDLLNGVKLVVETPEETLFTYQGA
SVILPCRYRYEPALVSPRRVRVKWWKLSENGAPEKDVLVAIGLRHRSFGDYQGRVHLRQD
KEHDVSLEIQDLRLEDYGRYRCEVIDGLEDESGLVELELRGVVFPYQSPNGRYQFNFHEG
QQVCAEQAAVVASFEQLFRAWEEGLDWCNAGWLQDATVQYPIMLPRQPCGGPGLAPGVRS
YGPRHRRLHRYDVFCFATALKGRVYYLEHPEKLTLTEAREACQEDDATIAKVGQLFAAWK
FHGLDRCDAGWLADGSVRYPVVHPHPNCGPPEPGVRSFGFPDPQSRLYGVYCYRQH