GENSCAN 1.0	Date run: 15-Jan-104	Time: 09:40:42

Sequence ANXA2_1 : 53043 bp : 45.07% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1268   1310   43  1  1   94   59     5 0.613  -1.03
gtgggagcgggccgtgtaagggggaggcggggcggggcggggcgggcctcgcctcgccta
gggaggatgtggcgggtataaaagccccacccaggccagccggctctgctcagcatttgg
ggacgctctcagctctcggcgcacggcccaggtaagcggggcgcgccctgcccgcccgcg
ATGGGCCGCCAGCTAGCGGGGTGTGGAGACGCTGGGAAGAAGG
gtacggcctggcagggaggccccggcaactggccccggaggccgtcgggggcagggggct
gaagggacggccggcactggagagtctttggggagggggctcagggacaaggtgtttggg
gcaggggtgaggggccaccggccctcgggccgggagggtgcagggcagaggtggtggggg

 1.02 Intr +  13095  13153   59  1  2   81   95    45 0.174   3.10
gaccatctctgaggtttagtttttacagtcgtaagatgggaattgcatctgtttgcaaaa
actactccaatatcgtcagatgaaatggtccaaggagtagaaattagcataatgaatcgc
tgtgcttcagagtaaaggagagcctcttcataaagactttttgttgtactttttttccag
CTTCCTTCAAAATGTCTACTGTTCACGAAATCCTGTGCAAGCTCAGCTTGGAGGGTGAT
gtaagtatatcactttcactttatataatttttgcaagttggacatctctctggataacc
atattactctctatccttgtacatctaaggaagatggggacaattcagacagtcatcatt
tggttctcctctttcttaatacttcagctgttcctagtagttcaatttgaaggaaatatc

 1.03 Intr +  16740  16839  100  2  1   65  100   129 0.984  11.48
ttagaaaaaatgaaattgcttgcgtgaagtgtgatggtgtgttaatacctacctagttac
ctagtatgagaatgatctgaattgttaaaagaaacaataggaaaacatattaggcattgt
tatttcaacaagaggattttaaatgtgtgtcatttgagtatgtttatcttttaacctcag
CACTCTACACCCCCAAGTGCATATGGGTCTGTCAAAGCCTATACTAACTTTGATGCTGAG
CGGGATGCTTTGAACATTGAAACAGCCATCAAGACCAAAG
gtaggtgatacatttgtcctcttcttgtcagggtcttactgagacatttttggttgtctc
tttattctccctcaaatcgccatacgttggcgatttgaaattgtcatcgagctttaatgg
agtagatccagacctagctcaacccatgcctcctttccttccttccctccttcctttctt

 1.04 Intr +  25852  25959  108  2  0   91  101    74 0.959   9.26
acagcaggggttccgggccagccagcaccctggctgaaggtgcttttgggtagtcctatg
gctagaggggagcttttctctccctaaaaatctctctcactagatggatgactggctggc
ctaacaggcttgtttggaaggacttcctccctttgctgagttattcatgtctctcctcag
AAGAGAGTCTTCTAGCTCTTTCTGCTGAAGAAAACCTCAACTGGGTTATCCCTTTAGTGG
CCATGCATTATTACCAGGTGGCAAATCATTATCTACAGATTACCAAAT
gtaagtgcatttgtatgtaaaaatttcagcccagttctctacacgtgttgacacattatt
gtaccatatcctttgtaggagctagatggtggagtgtggtatgaaaaagtatcaaagtat
aattttaaaaaggtacaaacttgactcataggataaacatatactaaacttttaatgcac

 1.05 Intr +  34658  34752   95  0  2   96   87   154 0.999  15.78
agtgtacacattgggtagaggatgctgacgaaagagatagaacaaatcttggtgtctggg
tatttcagtttggaaaacagtatataaatttcagtttgaaaaagtctgcttgacaccttc
tatgtaagcccaaaatactagagtatactgagtaacgattaacaacttgtatttccatag
GTGTGGATGAGGTCACCATTGTCAACATTTTGACCAACCGCAGCAATGCACAGAGACAGG
ATATTGCCTTCGCCTACCAGAGAAGGACCAAAAAG
gtacaggcaattccagggatggagggcatttcttgttgaatttttgtttcctcagacatt
gctttttcttttcatgaattgtggctctcatgcgcaaaagacttgtgggacccttggata
tctaagattttcttcttaaatccttgtaagagtcactgcacatgtgtgtgtgcgtgtgtg

 1.06 Intr +  38127  38240  114  2  0   53   94    90 0.989   6.74
tttatgtttctgagatgtgggtctgttgaagggaatgcagttgagggcgtttgacccaag
actccggagtggtcaaagactcacaacctgcttcacaaaaagatccctcttacttttgtt
ttactcactagttttaaagtaaaataaatattttccttatgattgcctgttatcttgaag
GAACTTGCATCAGCACTGAAGTCAGCCTTATCTGGCCACCTGGAGACGGTGATTTTGGGC
CTATTGAAGACACCTGCTCAGTATGACGCTTCTGAGCTAAAAGCTTCCATGAAG
gtaaatgcatgtgagatgtcatctctgtcaaatctgctattaattttgtgaattacagct
ttctgagtgtaatttggtgattttcagttttgttgaattctcatttggaaccatttttta
aaaatgaactgaagttatatgtctcaggatttgtaccaaaaatatttcaattacttgttt

 1.07 Intr +  41945  42035   91  1  1  110   87   127 0.999  14.37
aatagaaaatgccattactttgtgctaaggggtaggagtatagattcttcagaaggaatg
tagaaagcaggatgctaacagacccaatccatgtttgcaatttacttgatggagatcaga
gaagtaggctaatggtggggaagcatttccctgctgatgttcgtgcttcctggttcacag
GGGCTGGGAACCGACGAGGACTCTCTCATTGAGATCATCTGCTCCAGAACCAACCAGGAG
CTGCAGGAAATTAACAGAGTCTACAAGGAAA
gtgagtagcttgatttctgtgattcatcctctcagcccaatttatgtgactctatcatgg
ccactggggttagggttcgggctaagatgcctgcattagtgatgtgcagaagtgcctgcc
accttgactatgcaggcaaggttggctgtggtccaagtttctctccttcacctcctcatt

 1.08 Intr +  43183  43262   80  2  2   18   81   144 0.874   5.97
tttcatgagggcgaaaatcattctagtgaatccttcctctgtttggggttaaggagaatg
gatatgtccagctgacgtagctgttctgcttctcagagtcttagtgggaaatggggagat
tggggtggatggttggctacacaggcagaaagcataaaaccagatgtattttcctccaag
TGTACAAGACTGATCTGGAGAAGGACATTATTTCGGACACATCTGGTGACTTCCGCAAGC
TGATGGTTGCCCTGGCAAAG
gttggtttcccagtttctttctttgcccttgcttcctcccaaggcaagtcacatacctca
ttttatacttggagtgaattaactaaatcccctgtgcctgcatcagaaattcagctgcat
ttttgaaagtgggtttgcactgtcactgcagagttgtcaattttgtataataggatttct

 1.09 Intr +  44968  45027   60  0  0  111  114    86 0.961  12.43
ctaggattacaggcgtgagccaccgtgcccggccccatctatgtttcaaagtaagaaaaa
tcttacgtggttacttatttaggaaattaaataatggcgtacatggactggggagaaaac
attttcagttttaaaatacacaaagaaatgtatttgaagttctttttctttcccccatag
GGTAGAAGAGCAGAGGATGGCTCTGTCATTGATTATGAACTGATTGACCAAGATGCTCGG

gtaagtgctgagctttttgctttgagtttttgttttctggtaagtctctggatagtctat
atagtaatttaactctgtgtgacaaatgactcccaaactctgtggcttaaaacaacaaac
atgtattatttctcagtttctgtgtgtcaggaattgaggagtagattagcccaattgttc

 1.10 Intr +  46705  46798   94  0  1   73   86   121 0.999   9.94
gactgcttgtgattaagacttttgacctaaatagtaggtctctgcccatgtctgcagtat
aatcatctttcctcgtttggcattttgaatgtgtagctttttttgttttttttgcatgac
attttttttgacgttacattggatgtgtagttaacttttcctggttggttgtactcgtag
GATCTCTATGACGCTGGAGTGAAGAGGAAAGGAACTGATGTTCCCAAGTGGATCAGCATC
ATGACCGAGCGGAGCGTGCCCCACCTCCAGAAAG
gtgggcactgtgctgagggagtctcagtgccttggggccctggctggggcggctgggtgg
atgtccatgttgggatggagtctgccagaatgaggttctgtctccgcttggcactctcat
aggctcacccattttccctcacctttctctcccattctggattcttttctcttgcaaata

 1.11 Intr +  47362  47457   96  2  0  107  106    95 0.999  13.18
ctgttccacgacaaacttggccaatgttggctctggtcaccgtggtaacctctaagctcc
taggatgctgtgatcatcctcaatttttaaaaaaattatggtgcataaaactaggtgggt
gatcgttgacagctttgactagtggctcggatctgataactctttgttgtttttcctcag
TATTTGATAGGTACAAGAGTTACAGCCCTTATGACATGTTGGAAAGCATCAGGAAAGAGG
TTAAAGGAGACCTGGAAAATGCTTTCCTGAACCTGG
gtaagtgaatgtggcccccattcctggtagacatcagctaccagagcagaagtgacagat
ggccatcctgttaatccaaatgtgtttgggaggtgtggcttctatgcatgctttggatag
ttttacagtcttaattgtatagatttcagaatataaaactgaagaaaggcctaacttggt

 1.12 Intr +  47930  47988   59  0  2  134  116    99 0.995  15.90
gtggtggaacttagtattgcagaggatttctagatttcccttagcctgtcctattttgca
gcccttttccattgcattaggtcacttctggtttgtggcccagggccagggcatcctctc
tcattggtagaggagagaccagagcagctgcagcgctgactccctttcttctctccacag
TTCAGTGCATTCAGAACAAGCCCCTGTATTTTGCTGATCGGCTGTATGACTCCATGAAG
gtaagggcagctggctgagagagctgtgtttccacactcagcttttcttcttttgggtcc
caaattgagtctccttgattcatggatggaggaaggggaccccactgtgtggatgcagga
acacactagtcagctgtggttgtatgtgacagctgagagaaccacaaatctgtcttcttt

 1.13 Intr +  49984  50106  123  0  0   50  115    73 0.445   6.98
gtttgtgttaagtgctgtatgtggaatttttcattgtggcatcatgtcggcactgaaaaa
gttttggattttggagcattttagatttcagattttcagatcagggatgctcaacctgta
gacgctttctttaacgataacattctcagcgaatgtaacaaatatcaacttgattttcag
GGCAAGGGGACGCGAGATAAGGTCCTGATCAGAATCATGGTCTCCCGCAGTGAAGTGGAC
ATGTTGAAAATTAGGTCTGAATTCAAGAGAAAGTACGGCAAGTCCCTGTACTATTATATC
CAG
gtaagcccgaggtgcagtgtcagcctgccctgccgtccagagcaccccgggccctggcag
gtggcctggcagaatgatgacagagtggcgattttctgttttctgactctctggggaaga
gatgctagtcatcaactatcagggatttattttgaaagcaccatttgtgatttgtcctgg

 1.14 Term +  51492  51551   60  2  0   54   48    92 0.668  -0.40
gcttccctggcaatggtttgggtgtggccttccaggcctttgtatcagggcaggtctcct
gcagagtcttctctttgtcatgggagaagcttcattgtgcgttgaggctacttctgtgtt
attgaggagtctgggcttttttctgataccacgtttcttttctttcctgggccattgtag
CAAGACACTAAGGGCGACTACCAGAAAGCGCTGCTGTACCTGTGTGGTGGAGATGACTGA

agcccgacacggcctgagcgtccagaaatggtgctcaccatgcttccagctaacaggtct
agaaaaccagcttgcgaataacagtccccgtggccatccctgtgagggtgacgttagcat
tacccccaacctcattttagttgcctaagcattgcctggccttcctgtctagtctctcct

Predicted peptide sequence(s):


>ANXA2_1|GENSCAN_predicted_peptide_1|393_aa
MGRQLAGCGDAGKKASFKMSTVHEILCKLSLEGDHSTPPSAYGSVKAYTNFDAERDALNI
ETAIKTKEESLLALSAEENLNWVIPLVAMHYYQVANHYLQITKCVDEVTIVNILTNRSNA
QRQDIAFAYQRRTKKELASALKSALSGHLETVILGLLKTPAQYDASELKASMKGLGTDED
SLIEIICSRTNQELQEINRVYKEMYKTDLEKDIISDTSGDFRKLMVALAKGRRAEDGSVI
DYELIDQDARDLYDAGVKRKGTDVPKWISIMTERSVPHLQKVFDRYKSYSPYDMLESIRK
EVKGDLENAFLNLVQCIQNKPLYFADRLYDSMKGKGTRDKVLIRIMVSRSEVDMLKIRSE
FKRKYGKSLYYYIQQDTKGDYQKALLYLCGGDD