GENSCAN 1.0	Date run: 15-Jan-104	Time: 07:39:05

Sequence ZFYVE26_1 : 72461 bp : 43.45% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1821   2014  194  2  2   72   94    74 0.500   4.84
caagcaagtcccgcctttcccaggcggaccagtagttgctgctttgtcttaatacagtgc
cttctgtttcttctcactggcgttgtgttgtttctaggaggtactccgcgaatgagaaca
ttgagaatgtgttcggcataactcatttctttgtatctccctgcactctgtgctgggaaa
ATGAATCATCCATTTGGAAAAGAGGAAGCTGCTTCGCAGAAGCAGCTTTTTGGATTTTTC
TGCGAATGCCTGCGGAGGGGAGAATGGGAGCTGGCACAGGCATGTGTACCTCAGCTACAG
GAGGGACAAGGGGATATCCCAAAGAGGGTAGAAGACATACTTCAGGCATTGGTGGTGTGT
CCAAATCTGCTGAG
gtaagggatctcttttcctaccagacggtcccagggtgagagacatgtggttcaatattt
gggcattggtcaatgtgcccccactcaactaccctctgaagaataagcagaggcacagtg
tatttcacgtgctctgaaattttacctctatagtatacatccattacttagtcaatattg

 1.02 Intr +   3720   3798   79  0  1   94  115     7 0.797   3.55
gcctggcctggttccaatgttttactgaactgtcatatacatttaaaaatatctcattag
ggcagtgtcttgcctgttcaggtttaaaacagaataagcaatgaaatctgtcttggatga
caaaagatgaaagatcagtagaaactcttttttacaagtctttctttttacctttttcag
ATGTGGGCAGGACATCAACCCTCAAAGAGTAGCCTGGGTCTGGCTTCTTGTACTGGAGAA
ATGGTTGGCCCGGGAAAAG
gtaagtaggtttatattaaattttcctccgaggccaggactgagaagaacttgaaagtag
ttgtgggatttcccttctgtctgttacttcctttatcattaaattcatcatactcattct
caaagaatggcttaaatttttattgctgtctccttacctaaattcattcattaatgcact

 1.03 Intr +   8495   8584   90  1  0   76   78    35 0.725   1.49
gcctggggaacagagcaagactctgtctcaaaataaaaaaaaaaaaaaaaaaaaaaaaaa
agagtgcttcatcttagagaaatagcagaaataagactaactggacagaaatatttaatt
ataatttgttaactaaaacatatatctcatctctatgcttcattcttttgattcttctag
AAGTTACTCCCAGTTGTTTTCCGGAGAAAGCTTGAGTTTCTTTTATTGTCAGAAGACCTC
CAAGGTGACATTCCAGAGAACATCCTCGAG
gtgagagagagccctggtaccatctgcccagggttgacagtcacttaagcagcttagctt
ccatggacccagaagagagaggtctccaagatgttgcccatactttgttctcaggcaagg
caacacagaagctcctttgaggagagtttagagttagggtaaacttatatgattttagaa

 1.04 Intr +   9864  10386  523  2  1   78   93   485 0.961  40.52
atttgatttttctgtgtaaagggccttagaacaatgtctaacacatagtaactacgacat
aagtatttgttaccgccactattatataagtaaactgaaaaagaggaaagcatgaaggca
cacaagtgataccattccaggcatgcccaccacccatccttttcttcatcctctatttag
GAGCTGTATGAGACCTTAACACAGGGTGCAGTAGGCCACGTGCCTGACGGAAATCCAAGG
AGGGAGAGCTGGACTCCTCGTCTCAGCTCCGAAGCTGTCTCTGTGCTCTGGGATCTCCTG
AGGCAGTCTCCCCAGCCAGCACAGGCCCTGCTGGAGCTCCTGCTTGAGGAGGATGACGGT
ACTGGCCTCTGTCACTGGCCTCTGCAGAATGCACTGGTGGACCTCATTCGAAAGGCATTG
CGGGCTTTGCAGGGCCCTGATTCGGTGCCCCCTGGGGTAGTCGATGCCATCTATGGAGCC
CTGCGGACTCTGCGTTGCCCCGCAGAACCACTTGGGGTTGAGTTGCATCTCCTGTGTGAG
GAACTACTAGAGGCCTGCAGGACCGAGGGGAGTCCCCTGCGGGAGGAGCGGCTGCTCAGC
TGCCTGCTGCACAAGGCCAGCCGGGGCCTGCTGTCCCTGTATGGCCATACCTATGCAGAG
AAGGTCACAGAAAAGCCACCGAGGGCTACAGCCTCGGGAAAAG
gtgtgttccctttgctgctgctcctttagtttcagtaattccagtatgcccagccttgct
ggaggctctagactgctgccttccgtgtggctcaggacatctaataggggaggctaagca
aaaatgggtgcgatgctctttcgtaaaagtacaggcctggcatggtggctcaggcctgta

 1.05 Intr +  11109  11239  131  1  2   60  119   117 0.970  12.41
gcttttctgaagctcccaagggaagtaaagattctttaagataccctaagataaagtatg
gaaaacccagcctaagtttttaaaagagcaaactctcacatcacttggttgttcaaatgg
gctctagcttagaaaagaagagttcttggtttcctgataaccgtcttgtttgatgttcag
TCTCACCGGATCATCTAGATCCTGAGCGGGCAATGCTAGCCCTGTTCTCCAATCCCAACC
CAGCCGAGGCTTGGAAAGTGGCCTATTTCTACTGCCTGAGCAACAACAAACACTTCCTCG
AGCAGATTCTG
gtaagtcaagcttaattgttcatcacagaggtacccagggattctccccagactttttca
ttcctcatttctctcccactcatttggccaccataaagcagtctaattagtgttgagtca
tttggttttgtccctcccacagtcccatgggaaaggagactctgagaatcagtgccattc

 1.06 Intr +  12166  12330  165  0  0   83   93    13 0.615   1.46
ctttggcctcccaaagtgctgggattacaggcatgagccactacgcccagccaaccactc
ctgttattgtcagaaatctccctgctgtactaaaatacttctttctctaaagagcagtaa
gctagaacccattctgtctcatccacatagctgcctataacagctttctttgacttacag
GTAACAGCACTAACATTGTTGAAAGAAGAAGACTTCCCAAATCTTGGCTGCCTACTTGAT
AGAGAATTCAGGCCCCTCAGTTGCCTGCTTGTACTCCTGGGCTGGACACACTGCCAGAGC
CTAGAGTCAGCCAAGAGGCTGCTCCAGACCCTGCACAGGACCCAG
gtaactctcactcagcatcccaggctgctctggaagtgagagacgtggggcttcgggctt
aggctgaatgcagagccctaaaatcagtcataatctgtaaccccaggtgcctgagtcagc
atctctttcttctcccatatcaacatagggcccaggctgtgatgagctcctcagggatgc

 1.07 Intr +  12479  12567   89  1  2   66   80     7 0.441  -3.53
agaggctgctccagaccctgcacaggacccaggtaactctcactcagcatcccaggctgc
tctggaagtgagagacgtggggcttcgggcttaggctgaatgcagagccctaaaatcagt
cataatctgtaaccccaggtgcctgagtcagcatctctttcttctcccatatcaacatag
GGCCCAGGCTGTGATGAGCTCCTCAGGGATGCCTGTGATGGGTTGTGGGCTCACCTGGAG
GTCCTGGAGTGGTGCATACAGCAGAGCAG
gtatggccctgtgcagtcagcgcctgcccaccacagggcacagctgaccctgtgctccgc
atgtgtggccatttcaaggcgttttccacataaatgttttgagttggcaatgttgaccag
ctactaaaaattgttccaacaattaaaccaagaaagaaacacaagtaattattaccttca

 1.08 Intr +  13520  13683  164  2  2   76  105    17 0.424   1.82
ttccctgagggtaaataaatgttaggctcagtcccaaaccaactaaaatttagattgtag
ggaagggaagcctgtggcattatggtccagagaggaagaacaagagggaatggagattga
tctttcttcgagcaataatataaactgcctctcttccatcctcccaacttttccattcag
CAACCCCATACCAAAGAGAGATCTGTTGTATCATTTACACGGTGGAGACAGCCACTCAGT
GCTCTACACTCTCCATCACCTTACAAACCTTCCAGCCCTCAGGGAGGAAGATGTTCTCAA
GCTCTTACAGAAAGTGCCAGCCAAGGACCCCCAGCAAGAGCCTG
gtgagttgggatggaatgacctggccaggatttcctcttaggacattcttacacatttct
tccagcatgagatttatccagatgtgattgctgagatctttcaagagggtggtgaggagg
tctcctctaaatgagcactgtttgtcctaatcagtttatgggatatagggcattcctcct

 1.09 Intr +  15502  15705  204  2  0   87   92   177 0.880  17.17
agttgatactgacttgaggaaaagccctagaagtgacacagatcagaccgacagaaagga
gagagggtaagaacctacaagtggacctctaagtatggcacagcatctctttgcttcacc
catacttgcatcctgaattaattaactctcaagttcagcctgtttctctttgtaattcag
ATGCAGTTGATGCTCCAGTCCCTGAGCACCTGAGCCAGTGTCAGAACCTGACACTCTACC
AGGGCTTCTGTGCCATGAAGTATGCCATCTATGCCCTCTGTGTAAACTCACACCAGCACT
CCCAGTGCCAGGACTGCAAAGACAGCCTCTCTGAGGACCTGGCCTCAGCTACAGAGCCAG
CGAATGACTCTCTCTCCTCCCCAG
gtacagcacttccctccatccgtgagataagctgataacaacacatgccagtgggtgctt
tgtgtgtttaccctcttccaccaagattgggagtggggtgatggccttggttttatttca
cccagggatagtttcatccatctgtcagcctctgaatcaaagggacatggaaaaagaaag

 1.10 Intr +  19162  19770  609  2  0   95   94   229 0.074  16.59
cattaaaagacatcctaagtctcttattcttctcactgtaacctcagttcccttataatt
aaaaaataaataaatgagctaaagttgcgagaatgtttgacgctgggaggtaatgtttct
aatgtttgcattctctgtcttctctttctctggcctcttctcttgtacatgtttttgtag
GTGCTGCAAATCTCTTCTCAACTTACCTGGCCAGGTGTCAACAGTATCTGTGCAGTATTC
CTGACTCTCTGTGCCTGGAGCTTCTGGAAAACATCTTCTCATTGCTTCTCATCACCTCTG
CTGATCTTCACCCAGAGCCTCACTTGCCTGAGGACTATGCTGAGGATGATGACATTGAGG
GGAAGAGCCCCTCAGGTTTGAGGTCCCCATCAGAGAGCCCTCAGCACATAGCACATCCTG
AAAGGAAGTCAGAACGGGGTTCCCTGGGAGTCCCAAAGACCCTTGCTTATACAATGCCAA
GCCATGTGAAGGCAGAGCCAAAAGACAGTTACCCAGGGCCTCATAGGCACAGCTTTTTGG
ACTTAAAACACTTTACTAGTGGTATCAGTGGATTTCTGGCTGATGAATTTGCAATAGGGG
CCTTCCTCAGGCTTCTCCAAGAGCAACTGGATGAGATCAGTAGCCGCAGCCCTCCTGAGA
AGCCAAAGCAAGAAAGTCAGAGCTGCTCAGGAAGCAGAGATGGACTGCAGAGCCGCCTGC
ATCGACTTTCCAAGGTTGTCTCTGAGGCCCAGTGGAGACACAAGGTGGTGACAAGCAACC
ATCGTTCAG
gtgagagaagggtggaactggtgggaccagaaggtggagagggagaaagatcccaggaat
atgggagagagctaggagtacataggagtcaccccataactcagggcatatcgtcaccat
ggcaaccagtgtcagaacactggggtatgctccatgtctcagagcccagtgcaaaccttc

 1.11 Intr +  24025  24176  152  2  2   87   94    57 0.940   6.08
cttctattcaaagatggtagcataggtttgcccttcatttgaggaaaaattaagacctat
ttacaggccttttacagaaggacattgaggagataaaagtttggtgggaggtggcagcaa
tatagcatttccttaattcctcttgcttctctggccccacacattcttgtgtcccaacag
AGGGAAGTCTGAGTGCCATGTCTGGCCGGAATGAGCTGCACAGTAGATTGCACCCCCATC
CTCAAAGTTCACTCATCCCCATGATGTTCTCCCCACCTGAGTCACTGCTGGCATCCTGCA
TCCTTCGCGGGAACTTCGCAGAAGCCCATCAG
gtgaggggaggccataccttttcagcccctgaatgacttagcatcaggtaaggctcggag
catgtacaaccagagccacctgggagcactcaggggtccacatcaagcagaagaagcaga
agcaagagggggtttccatgtgcccaggcccagtcttcagcagggtggattgaaagatag

 1.12 Intr +  27011  27212  202  1  1   90   71   328 0.998  30.16
acttttatgaattattttttatagttgacctgctcttctaacattcagtgctcttctgac
cctacaaagcacaaagacatcttagggccacagtctaatggttggcaagatctcctatcc
atggacattccctaaatcagtgggaccaccagggcccacacactccctctcctatgacag
GTGCTGTTCACGTTCAACCTGAAGTCCTCACCCAGTTCAGGGGAACTGATGTTCATGGAG
CGCTACCAGGAAGTGATCCAAGAACTGGCCCAAGTAGAGCACAAGATTGAAAACCAGAAC
TCAGATGCGGGTAGCAGCACCATTCGGAGAACTGGCAGTGGCCGCTCAACTCTACAGGCC
ATTGGCAGCGCTGCAGCAGCAG
gtcaggcttccctgctaacaccataagtggtgaggtggctgggagagggggtaaaagggg
agaaaccactaaaatcctaggctcctcatgagggtgagcagaaattaaatacaggacacc
tgccttgaaaaacagcaaacctgatacgtccagttttccagctgtgcccatcctccttgc

 1.13 Intr +  28186  28449  264  2  0   42   84   214 0.995  13.88
tcctttcatgccactgttttgaagctataagagtgggccataatgatagtgctaatatac
atgaaagataccctgtgcagatgaacctcaaacattttgaaagtaactactttacctaat
aaaagttgtagtaagaatccttttaaccctttgctttttattcctctgctgggcggccag
GAATGGTGTTTTACTCTATCTCTGACGTGACTGACAAGCTGCTCAACACCTCTGGAGACC
CCATCCCCATGCTCCAGGAGGACTTTTGGATAAGCACGGCTCTAGTGGAGCCCACTGCTC
CCCTGAGAGAGGTTCTGGAAGACCTCAGTCCCCCTGCCATGGCTGCATTTGACCTAGCTT
GCTCTCAGTGCCAGCTCTGGAAAACCTGCAAGCAGCTTTTGGAGACAGCCGAACGGCGTT
TGAATAGTAGCCTTGAAAGGCGGG
gtgagtgtgctgtgttagctgtatcccttcattctcaaatgagatgggtttctgagagtc
ttgataaattgtccaggaagaaagcagttattggaggaggcagatggtgaatggattatg
aaattttgtcacatacaatctgatggcataaatacagtctgttgagagacaaaatagaca

 1.14 Intr +  31551  31670  120  1  0  100  109    28 0.923   6.57
gaatctcaggcatgaaataagccaagtatactggttgtcacccaaaatggcacagcatgt
atttcctccttaatattggagaggataaaatttcacaggtaaatacaggactgagtgtca
atctctgaaaacacttcaattttttttttttgcattccctcttccttcatctatttccag
GTCGACGGATAGACCACGTACTCCTAAATGCTGATGGCATTCGAGGTTTTCCAGTTGTTC
TTCAGCAAATCAGTAAGAGTCTCAATTATCTGCTTATGTCAGCCAGTCAAACCAAATCAG

gtgagttgcttttttctcttttcttctcctggacttggaacattaggtcagcaacagact
ttactttttctttctcatttgctttccatagagagtgtggaagaaaagggaggaggccct
ccacggtgcagcatcactgaactgcttcagatgtgctggcccagcctaagcgaggactgt

 1.15 Intr +  31762  31926  165  2  0   94   75    64 0.980   5.63
tgatggcattcgaggttttccagttgttcttcagcaaatcagtaagagtctcaattatct
gcttatgtcagccagtcaaaccaaatcaggtgagttgcttttttctcttttcttctcctg
gacttggaacattaggtcagcaacagactttactttttctttctcatttgctttccatag
AGAGTGTGGAAGAAAAGGGAGGAGGCCCTCCACGGTGCAGCATCACTGAACTGCTTCAGA
TGTGCTGGCCCAGCCTAAGCGAGGACTGTGTTGCCAGCCACACCACCCTCTCCCAGCAGC
TAGATCAGGTCCTTCAGTCACTGAGAGAGGCACTAGAGCTGCCAG
gtataaggctgtctgcttgggaacaaataaaagctgaactggggagaggaaacagctgag
agtaacgaagcactttggagcagaggcttgggactccagaactgggatctatcagccctt
tagttagccagggcatgtctcaatgtctcgtaacttaacttcacctgttttcccacctct

 1.16 Intr +  32507  32725  219  0  0   98   82   123 0.929  10.97
atcacttgtccaagtgactgacttaggattttatatttgccttgtaagtgtagtgtccag
gccatcagatgccccaggcagtgtatagggggcacagttcacatatccagtcagaaattg
acccaaagctggactcacagactgaagcctgtgtcctttctcctgccatcctcctctcag
AGCCCAGGACTCCTCCACTGTCTTCCCTGGTGGAGCAGGCAGCCCAGAAAGCTCCAGAGG
CAGAGGCCCACCCTGTGCAGATCCAGACTCAGCTCCTCCAGAAGAACCTGGGCAAACAGA
CCCCATCAGGCAGCAGGCAGATGGACTACTTGGGCACCTTCTTCAGTTACTGCAGCACCC
TTGCTGCAGTTCTCCTTCAAAGTTTGAGCTCTGAGCCTG
gtaggtagcaagaaagaggcaatagattcatggcagacctgcaagtgttcagggcaagga
agagaaaagatgcacaattgaaaggctctggatacagcagtagccaagaacactagattt
ataaggttgtcctctcttattcatctctggctattttactcatctttgtgctagtatagc

 1.17 Intr +  33348  33450  103  1  1   67   75    10 0.862  -3.17
atagataaaacttgtggtcaggttcatgttgagaataccctttacctagaatgaattaac
agaaggctctccatattgtcttcatcttgacactgtacttttttctcaattctgggaaac
agggctctgaactcttgcagtcagtggtgcaaacaaagatcatgttctttacctttgcag
ATCATGTGGAGGTCAAGGTAGGAAATCCCTTTGTTCTGCTGCAACAGAGCTCTTCCCAAC
TGGTGTCACATCTCCTGTTTGAGAGACAAGTTCCCCCAGAGAG
gtaggagccacctccatgcaagtcagccatgggccttcggatgatttcatcaatatagcc
aagggctcagtgcggtggtgcttggggttagcacagagagtggggatttcttcctgactg
aattttttattcttatataactgaaaatttaatgtgccttgtttcctgctttctctctcg

 1.18 Intr +  34259  35004  746  2  2  123   77   226 0.851  16.10
gtgaaaacataaagggcagagcgatatgtctaataggctactttttgtgttttaaaaaaa
gagtgtgacaattaggaacttttatttacatttgctcatgtaagcataaagaaattgtaa
gactggttaatggtgcctgtgtattcaggccttgtatgctttctgcttctctccttccag
ACTGGCAGCCCTTCTGGCCCAAGAGAATCTCAGCCTAAGTGTGCCACAGGTCATCGTCAG
CTGCTGCTGTGAGCCCCTTGCTCTTTGCTCATCCCGGCAAAGCCAGCAGACCTCCTCCCT
CCTGACTCGTCTGGGTACTCTGGCCCAGCTACACGCCTCTCACTGCCTGGATGACCTCCC
ACTTTCTACACCGAGCTCCCCGAGGACAACTGAGAACCCTACATTGGAAAGAAAGCCCTA
CTCCTCCCCAAGGGACTCATCACTCCCAGCCCTCACCTCCTCTGCCTTGGCCTTTCTTAA
GTCACGCTCAAAGCTCCTAGCTACGGTGGCCTGCCTGGGGGCTTCCCCGAGGTTAAAGGT
CAGCAAACCCAGCTTGTCATGGAAGGAACTTCGTGGCCGCAGGGAGGTGCCTCTGGCTGC
AGAGCAGGTAGCCCGGGAGTGTGAGCGCCTTCTGGAACAATTCCCTCTGTTTGAGGCCTT
CCTCCTGGCTGCCTGGGAGCCCCTGCGAGGGTCTTTGCAGCAGGGGCAGAGTCTGGCAGT
GAATCTCTGTGGTTGGGCCAGTCTTTCTACCGTTCTCCTGGGCCTACATTCTCCCATTGC
CCTAGATGTACTGAGTGAGGCTTTTGAGGAATCCTTGGTGGCCAGAGATTGGTCCCGGGC
CCTTCAGCTCACTGAAGTGTACGGGCGAGATGTGGACGATTTGAGCAGCATAAAGGATGC
AGTCCTGAGCTGTGCTGTGGCATGTG
gtgagcagaatgctatgcctccctttttcactagtggtaatatttggtattcactgggta
tattatcacatttaatcctcacggtaactctagagagaagccccactataatctcatgtt
attaagaggagaccaggtctcagaggggttaggaaacttgcccagggtggtaagtggtag

 1.19 Intr +  36255  36451  197  1  2   93   86   199 0.984  19.33
ttttccttgtcatataatggttccaagtgtaaaaactagttaagatcacatccatcttaa
ggatcctccaagctcctcttttacgagattgaagaaagccctttctcaagaagtaacctg
gactcttgaactcttctggtcccacgcttgctgcctctgagcatcttttttgtcttatag
ACAAAGAAGGTTGGCAATACCTGTTTCCCGTGAAGGATGCATCTCTGAGAAGTCGGCTGG
CCCTACAGTTTGTGGACAGGTGGCCCCTGGAGTCATGCCTGGAGATTCTGGCCTACTGCA
TTTCAGACACGGCTGTCCAAGAAGGACTAAAGTGTGAGCTACAGAGGAAGCTGGCGGAGC
TGCAGGTGTATCAGAAG
gtatgggccctcgcatcaagagaaagggaacgggcttctcactctatgatcaaccccaac
ctatcttatatgatgggggactttaagaaagagaaaatataggtctgggttttgctttgc
atctggcttcagttcttaggtgaacagcagggaggcctcctagctggttgctgtgttact

 1.20 Intr +  37439  37543  105  1  0  104   86    26 0.943   4.41
ataggttcactctgctctctaaataatctttgcccaatttgctctcttttctggcaagtt
ctgacagcctgactttggggcagagatctagggatggcccatctgtggacatgcccagtg
acttgttcatggagggagaagctgcagtgtggtttgacggattttcttgtctttccttag
ATTCTGGGTTTGCAGTCTCCCCCAGTGTGGTGTGACTGGCAGACCTTGAGGAGCTGTTGT
GTTGAGGACCCATCAACTGTCATGAACATGATTCTAGAAGCACAG
gtaccgttttcctgggtggtgttccccttcatcctcctttcagagttacaaccccttagc
tggctgtataagcccctttctgcatatcaatgttcactttttaaaaaaataactatacca
cattctggccgaggcgggcggctcacaaggtcaggagatcgagaccacggtgaaaccccg

 1.21 Intr +  40049  40270  222  1  0   49  116   125 0.493   9.72
ctggtcctgtcaaagccatggcatttgggaaactacagaggtggttaaaaaaaaaaagga
gtatagagaaagggttagtccaaaatgagtaaacctaaatattctattctcaaacaaaac
aaagctggtctaagagctcttctgcaggccacaccttcctcctctaccctttgacaatag
CTCCTGCGAAGAATCCCTGACCCCACCATGTGCCTTGAAGTGACAGAGCAATCCCTCGAC
CAGCACACTAGCTTGGCCACTTCTCACTTCTTGGCCAACTACCTCACCACCCACTTCTAT
GGACAACTGACTGCTGTCCGACACCGTGAAATCCAGGCGCTGTATGTGGGATCCAAGGTA
AGGATACACCGTGAAATCCAGGCGCTGTATGTGGGATCCAAG
gtaaggaggaaaaggaggtgttgggaaggcatacctgagggagagactgcgagcctagct
cttcttcagaacttgccttttcaatggctcttttgccaggcacctgccatccctggcctg
tgctatatgaaatctttaccctagaagccctctgtatcctagttgagtctcctaggactt

 1.22 Intr +  41678  41924  247  1  1   31   93   296 0.952  21.43
attaccatctgcagaatttagtggggagctcagccttcctaaaagactgcgagtctgttt
cagtagctggctatgcaccttttgttctcatgcacccttccccttcccagtgagaatctt
gagttttttctgaaatttgtgtactattttctttactctatggatctaccccacaaacag
ATTCTGCTGACCCTGCCTGAGCAGCACCGGGCCAGCTATTCCCACTTGTCCTCTAACCCC
CTGTTCATGCTGGAGCAGCTGCTTATGAACATGAAGGTGGATTGGGCCACTGTGGCTGTG
CAGACTCTCCAGCAGCTGCTGGTTGGACAGGAGATTGGCTTCACTATGGACGAGGTGGAC
TCACTGCTTTCCAGATACGCAGAGAAAGCCCTGGACTTTCCATACCCTCAGAGGGAGAAA
CGATCAG
gtaactgctagcatcctagaaggggattctacatggaggaagaaatgccatgctgcattc
ttagttttaatttgctccccttttaatattttgggttgatctagagtgaatgaatacact
tcagaagagctatctctttattatataggagagatcttggtcttggaggaagtagaataa

 1.23 Intr +  42670  42768   99  2  0   73   99     6 0.544   0.28
ggcgtttaagaaacatgcgtgctatgggcttagaggtacctcctccattctcttaatacc
tagtagagtcatggaatgacaatcagagaagccaacagagctttgttctaaatgcctagg
gtggtgaatcaagatacttatggtagaaccatattttgtcagcattttccctctctacag
ATTCTGTGATTCACCTCCAAGAAATTGTCCACCAGGCTGCAGATCCCGAGACCCTCCCTA
GATCACCATCAGCAGAGTTCTCTCCTGCTGCTCCTCCTG
gtaagaactggctctgatgattcactaaaatttttcagtttagtcttgccttattctatc
cttcagaattttttttttttttttgcttctttttttcattgccagttacaacattattaa
ttgtttatcttggttcattccagatttatatatatctcaaaagattcaacatacagtcaa

 1.24 Intr +  45574  45737  164  2  2  112  103    28 0.864   6.39
caggaggcacacaatgttcagttgtctctcttttatgacacaaacagtcactgatgatca
ttaactggatctattctttcaataacggtttgtaaaatggtaaaattctatcattccctc
ttcatctataagctggtatattgattaccttttactctgacctctggctctgcctcccag
GTATCTCCAGTATACATTCCCCTAGTCTAAGGGAAAGGAGTTTCCCACCAACCCAGCCCT
CACAGGAATTTGTGCCCCCAGCGACACCCCCTGCCAGGCACCAGTGGGTACCGGATGAGA
CTGAGAGTATCTGCATGGTCTGCTGCAGGGAGCACTTCACCATG
gtaagcagcatcggtctccactgtcaccctcaggagaaggtaaaggagaattctagttca
tgagcctgagtttacaatcaccgcctgtccccaggagaatatcggtattttcagaactgc
caaatctaagactttgggttcatttttgacctgaccagaatgtattttctggattcagac

 1.25 Intr +  48054  48190  137  2  2   57   70    25 0.884  -3.03
atttttaaacattcaatttttgagggcaaggactggtgtgtccttttccaatagagaccc
aagcagttggtgttcttagaaagtataagccactggtagttaataccatgtataaatgga
ttgatggcaatctccccttctctcctccctctttcttctcctcctgatggcattcctcag
TTTAACAGGCGTCATCATTGTCGCCGCTGTGGCCGGCTAGTGTGCAGCTCCTGCTCCACT
AAGAAAATGGTGGTTGAAGGCTGCAGAGAGAACCCTGCTCGTGTGTGTGATCAGTGCTAT
AGTTACTGCAACAAAGA
gtgagtgtcctacagcagggctgttgctattattgaccgctgcacccttccgcaggtccc
tacactcctaggagtctcattatgagagcatttcaaatccagaaatgtttaacattcaca
ctgaaatgccattaactctacactgaagggtttgtacactgactttggtcagagaaacca

 1.26 Intr +  49236  49267   32  0  2  123  116    57 0.998   9.77
actgctgagatttgaaatgggcagttagtattgatgggggactctttcattcaacaattc
taccctcaaagagccctccattgtaccagggagacactgtaagttgatgctgtctacgaa
gctcaaaacaaagaagtgactcaggcatttatttaataatttttctttctctgttttcag
TGTACCAGAGGAGCCTTCAGAAAAACCAGAAG
gtaaggccaaatcccgttctctgtgactcttcatttgtgtacttaagttgactctatctt
cagcatatcagctgtgactgatatacttgtccaacttatgcactccatccaacttgtttg
ccaaagcaaattcttggcatttgtatcagcctgtttcctctgaagttcatcatattaacc

 1.27 Intr +  49944  50080  137  1  2   82   90   161 0.921  15.99
ggaagatggtttgaggtgcttagtggggtgtcctaaagcaaacaaaaggaaccaaggaga
gagaaaggggccctgagatagcaggcaagtgtctacctgcaactcatgccagctcactgg
actgggttagactgaactgccagccagtgaatgacacatgaatggcatttctcttctcag
CTCTAGACAGCTCCAAGAATGAAAGCCCTCCATACTCGTTTGTGGTGAGAGTCCCCAAAG
CAGATGAGGTGGAATGGATTTTGGATCTCAAAGAGGAGGAAAATGAGCTGGTGCGGAGTG
AATTTTACTATGAGCAG
gtaatagcaataaaatgcaatggtcacttaagtttctttatgatgtgtagcagtatgaca
agaaatacagaggtaggtgaacacacctggcctttacttgtttatagtgcaataatatgg
gagctaaaccagtaaatccattaaggcagaaaataatgaacatcttgggaattgcagaag

 1.28 Intr +  50188  50319  132  0  0   69   58   113 0.865   7.24
tgaggtggaatggattttggatctcaaagaggaggaaaatgagctggtgcggagtgaatt
ttactatgagcaggtaatagcaataaaatgcaatggtcacttaagtttctttatgatgtg
tagcagtatgacaagaaatacagaggtaggtgaacacacctggcctttacttgtttatag
TGCAATAATATGGGAGCTAAACCAGTAAATCCATTAAGGCAGAAAATAATGAACATCTTG
GGAATTGCAGAAGGGGAGACCAGGAAAGCCTTCGTGGAAGAGGTAGCATTTAAGATGAGC
TTTGGAAGAATG
gtaggagtgtgacaagcagaaagctgggggtcgtgaggagagtggggatggggaaggaca
aagaatacaaaattaaaacatctgagcaaagacaccgtgtccaaaattgcagggcatgat
tggagaagtggaagctctttaatttgaagggaacatagagtcaatagggttaatagagag

 1.29 Intr +  51337  51557  221  0  2   70   80   370 0.742  31.50
acttagaacatctgaaatttgtttagttccacttctgctttcttgtagaatctggttcct
tcttccagggtctttcagccttttgaaaggggaaggataatttctgccacccagctgcct
ttggagaatgctctggcccctggactcaccgtgtgttctcccttcttccaccccggccag
GCCCCCAGCGCCTCCTTGTGCATTGCCATCCTGAATCTGCACCGGGACAGCATTGCCTGT
GGTCACCAGCTGATTGAGCACTGCTGCAGGCTCTCCAAGGGCCTCACCAACCCAGAGGTG
GATGCCGGGCTGCTCACGGACATCATGAAGCAGCTGCTGTTCAGCGCCAAGATGATGTTC
GTCAAAGCCGGCCAGAGCCAAGACTTGGCTCTTTGTGACAG
gtagagggcagtgggtctctattcttttacacaggagcagtttctagccagcttcttttt
ctgaccccactgtgatttttttatctcaccatcctctctgacaagacatgctgaaagatt
tttcatctgtgtaatgttgatgaaacggtgttgccagatctcaagtgttcttccccatcc

 1.30 Intr +  54965  55112  148  2  1  101   78   129 0.999  13.44
acccaggaggcggtggttgcagtgagccgagatcggaccactgcactccagcctgggtga
cagaacgagactctgtttcaaaacaaacagaaaaaagaaaatggaataggaaacctttaa
gcggctactcttagtaagacactagggagcctcatggccttgcccttttcctccttgtag
CTACATCAGCAAGGTAGATGTGCTGAATATTTTAGTTGCTGCTGCCTATCGCCACGTGCC
ATCTTTGGATCAGATCTTGCAGCCAGCTGCAGTAACCAGGCTAAGGAACCAGCTTTTGGA
AGCCGAGTACTACCAACTGGGCGTTGAG
gtgagacaaagacaaagacaaagcttacttccaccccactgtagcaagttgcttttgctt
agccttgcaaacaggtgttgccgtctctcagttgtcctgcccatggggtagaatcgggga
catgactagtttgccagcagagaagtaatggcagatagtgggaatgaggtggttggcaac

 1.31 Intr +  55372  55581  210  0  0   69   91   106 0.869   8.11
gccgtctctcagttgtcctgcccatggggtagaatcggggacatgactagtttgccagca
gagaagtaatggcagatagtgggaatgaggtggttggcaacttgggaatagaataggtct
ttgggacatttaggcctgaatgtagctaccactcactaaaaggggcaatttttctcccag
GTCTCCACAAAGACTGGGCTTGATACCACCGGGGCGTGGCATGCTTGGGGCATGGCCTGC
CTCAAAGCCGGGAACCTCACTGCTGCACGGGAGAAGTTCAGTCGCTGTCTGAAGCCCCCA
TTTGACCTCAATCAGCTGAATCATGGCTCAAGGCTGGTGCAGGATGTGGTTGAGTACCTA
GAGTCCACAGTGAGGCCCTTTGTATCCTTG
gtaagagcaaggcaggaagagtgcctggctcagggagggagacccaggaatagcaatgac
ctgggaaaagaatcagtggaaattcagctaacagtgtcagtcctggctcagcatcaagca
ggttaaaaattttttttttccatcacatatagttagataagtaaccatatatggttagat

 1.32 Intr +  56200  56418  219  0  0   68   81   336 0.994  29.40
tatttttttatcatactttaagttctagggtacatgtgcacaacgtgcaggtttgttaca
tatgtatacatgtgccatgttggtgtgcacattgttaaatattctttgcaagcaatattt
tcagtgcctgctgagaactttttgagtttcatttttctctctcgctccctgtgctgtcag
CAAGATGACGATTACTTTGCCACCCTGAGGGAACTGGAAGCTACCCTTCGGACGCAGAGC
CTTTCTCTGGCAGTGATTCCTGAAGGGAAAATCATGAACAACACCTACTACCAGGAATGC
CTCTTCTACCTGCACAACTATAGCACCAACCTGGCCATCATCAGCTTCTACGTGAGGCAC
AGCTGCCTGCGGGAAGCTCTTCTGCACCTTCTCAACAAG
gtgggacatggacacagctcaaaaaggcagtgcctgccttactcctctggcttggaccac
tcagccttaagcgggacaataaccccctgacacttaaccctgtgttgagctatggggcca
tctctagcagagtcaagtcaaaacaggggactctgcacaactgttattcagtgagtgtga

 1.33 Intr +  61639  61836  198  0  0   94   90   138 0.999  14.15
gagaagtgaagcagtcgctagaatgagattctcaaaggtatctgtgacacataaaagatt
aagaagcactgcattgggaggatgctgaaggttcatcaatagaaggaaattcagagtgga
tcccagacagtgccagaaccaggctcaagacttctgacttctcgccctgccctgctccag
GAGAGTCCTCCAGAAGTTTTTATAGAAGGCATTTTCCAACCAAGCTATAAAAGTGGGAAG
CTACACACTTTGGAGAACTTGCTAGAATCCATTGATCCAACCTTGGAGAGCTGGGGAAAG
TACTTGATTGCTGCCTGCCAACATTTACAGAAGAAGAACTACTACCACATTCTGTATGAG
CTGCAGCAGTTTATGAAG
gtaatggcagccccttcctgccttctacctctgttgctggtgccccaccctgcaggagag
gcagtgcacgatgagggaatgagactgtcattggtccctggccttgctgtttggctgacc
ctagagcaaatccatgttgctctccagtattgttaaataatattaggatttccatcctaa

 1.34 Intr +  62534  62733  200  1  2  135   65   193 0.999  19.85
tgcacttcaggatctcttggaccttgggggtgactggctcaaaatagcagttcagctggt
ggtgggagtgggtgctggaaacaaggtctcataggcagaaatcagatgagaattctcatc
acaccccaccctccaaacccctgatctactttgacctgaacatttattttcctcttctag
GACCAAGTTCGGGCCGCCATGACCTGTATTCGGTTCTTCAGTCACAAAGCAAAGTCATAT
ACAGAACTGGGAGAGAAGCTCTCATGGCTACTTAAGGCCAAGGACCACCTGAAGATCTAC
CTCCAAGAAACATCCCGCAGCTCTGGAAGGAAGAAAACCACATTCTTCAGAAAGAAGATG
ACTGCAGCTGATGTGTCAAG
gtagctggaggttcaggggactattggtgtggggcagaaagggtgggagcagttgtctgt
aggtgatgaagctactcttgtccattccttgaatcctgaaaaaaaatctaaagggaatca
tccctggatgacagtgtgtagtacaagcctagaaagcctacagaggagctggtagtggga

 1.35 Intr +  63572  63713  142  2  1   92   83    51 0.996   5.36
cacgagatcaccatttttttggtcttgtcataactgctcacaaggtacttgaggtctctt
ttcccactatatcatttgttttccctttttcattgccatattattcgacttctcagtctc
ctggcctcagtcacctggggcccctcatgaggctggactgtgcatattctgtcaccacag
GCACATGAACACACTTCAGCTGCAGATGGAAGTGACCAGGTTCTTGCATCGGTGCGAAAG
TGCTGGGACCTCTCAAATCACCACTTTGCCTCTGCCAACCCTGTTTGGAAATAACCACAT
GAAAATGGATGTTGCCTGCAAG
gtacatgcagcgtttcagacctctggcagactattgtcatcttttagaacacttatcata
attgcagttgtctagtgattatttcagttgtttgtttgatggctgcctccccactagaat
atgagccaccaaagactggtgatcaggtccattttgatcattcttatatccctagtgcct

 1.36 Intr +  64018  64077   60  0  0  136   80    24 0.976   5.33
gccaccaaagactggtgatcaggtccattttgatcattcttatatccctagtgcctggca
cttagcagggtctcaacaaatatttgttgaataattgaataaatagaggccttcattctt
ggtcaagagtattctctagtaattgccatgtttttaagcatgattccctttccttttcag
GTCATGCTGGGAGGGAAAAATGTAGAAGATGGTTTTGGAATTGCTTTCCGTGTTCTGCAG

gtatgacttggatcattcaaatcatactgaggacaatcagcacctgaccacagttccggg
agagattattctttaggaaattcttatcccaagaaaagtggatttacatgcacattaggg
atgaaatcaaggatgtgactgttacagaactgggtcaaattcaagactctaggccacttt

 1.37 Intr +  65258  65440  183  1  0  122   86   257 0.999  28.88
tacctaactccaaagaggaattgacgcttgctttttgtttggtatatttatgttttctac
tgtgaccacaatcaatatggcttatctacaccaagcatagtgagagcttttaaatgctgc
ctccctccccaccgttaacgtttcctgctcctaagcccatcatgttgtgttctgttctag
GACTTCCAGCTGGATGCTGCCATGACCTACTGCAGAGCTGCCCGCCAGTTGGTGGAGAAA
GAGAAGTACAGTGAGATCCAGCAACTGCTCAAATGTGTCAGTGAGTCAGGCATGGCAGCC
AAAAGTGACGGGGACACCATCCTCCTCAACTGCCTGGAAGCGTTCAAGAGAATTCCGCCC
CAG
gtacactccctcccgtacctcttggctcctccatcaatttcagtgtcttcacatccccat
ctttattgttctgttttccataatgtgcctgaaactctacaagatccttttatcattctg
aacccctctgcaataatggcctcaccataattgacccttccctgtaaagaaaatttatgg

 1.38 Intr +  66688  66732   45  0  0  101  105    54 0.277   7.01
gaaaagccactacactccagcatgggcaacatagtgagaccccatgtctttgagaaaaaa
aaagtcaggcagacattttcattctgaagtcagaatggctgggctgaggctgggttgggc
cctggctcccagactgcgggactcttctccctctcacagtgctgtttctgttctgcacag
GAGCTGGAGGGCCTGATCCAGGCAATACACAATGATGACAACAAG
gtgagcggaattgtctccaaacgctggtgatgccaatgaattgtgtctcaggcttgccta
gtcacctttatcccttgctccccacaatagttccatacaacccgtatctcagcttctgta
ttatcagaggtggagctgaggcttggataggggtgtagaaaggagggaatagatgaggag

 1.39 Term +  69082  69348  267  0  0   49   43   224 0.327   9.49
gccttcttttttaaattcttagcttatttgtaataactttttacactataaaataacaca
gtgttatagcatatgtccagaatattgaaagagttgttataataccataaaatacatgaa
tcctgttatgaacgtggcaggtgagacatggtgtctgtctgcccgagctttctgctgcag
CTCTGTATACTTGATTTGTCGGTGATGGATGCCTTTCCGCTGTCTCTTATAACTGACTGC
CAGGTTCGGGCCTACCTGATATGTTGCAAACTGCGTTCTGCCTACTTGATTGCTGTGAAG
CAAGAACACTCACGGGCCACAGCCCTTGTCCAGCAGGTGCAGCAGGCCGCCAAGAGCAGC
GGGGATGCAGTAGTGCAAGACATCTGTGCCCAGTGGCTTCTGACAAGCCACCCCCGGGGT
GCCCATGGCCCAGGCTCCAGGAAGTGA
ccttgggcagtggggccaggaacacgtggcctgagagctgggcaacagcagtgatggcga
tgccctccacctctttcctccagtggagtgggacttctctggctctgccctaggttggaa
agagttggattggaccctacttgccttcccgggcaaggataggacctttcacgcaagtgc

Predicted peptide sequence(s):


>ZFYVE26_1|GENSCAN_predicted_peptide_1|2527_aa
MNHPFGKEEAASQKQLFGFFCECLRRGEWELAQACVPQLQEGQGDIPKRVEDILQALVVC
PNLLRCGQDINPQRVAWVWLLVLEKWLAREKKLLPVVFRRKLEFLLLSEDLQGDIPENIL
EELYETLTQGAVGHVPDGNPRRESWTPRLSSEAVSVLWDLLRQSPQPAQALLELLLEEDD
GTGLCHWPLQNALVDLIRKALRALQGPDSVPPGVVDAIYGALRTLRCPAEPLGVELHLLC
EELLEACRTEGSPLREERLLSCLLHKASRGLLSLYGHTYAEKVTEKPPRATASGKVSPDH
LDPERAMLALFSNPNPAEAWKVAYFYCLSNNKHFLEQILVTALTLLKEEDFPNLGCLLDR
EFRPLSCLLVLLGWTHCQSLESAKRLLQTLHRTQGPGCDELLRDACDGLWAHLEVLEWCI
QQSSNPIPKRDLLYHLHGGDSHSVLYTLHHLTNLPALREEDVLKLLQKVPAKDPQQEPDA
VDAPVPEHLSQCQNLTLYQGFCAMKYAIYALCVNSHQHSQCQDCKDSLSEDLASATEPAN
DSLSSPGAANLFSTYLARCQQYLCSIPDSLCLELLENIFSLLLITSADLHPEPHLPEDYA
EDDDIEGKSPSGLRSPSESPQHIAHPERKSERGSLGVPKTLAYTMPSHVKAEPKDSYPGP
HRHSFLDLKHFTSGISGFLADEFAIGAFLRLLQEQLDEISSRSPPEKPKQESQSCSGSRD
GLQSRLHRLSKVVSEAQWRHKVVTSNHRSEGSLSAMSGRNELHSRLHPHPQSSLIPMMFS
PPESLLASCILRGNFAEAHQVLFTFNLKSSPSSGELMFMERYQEVIQELAQVEHKIENQN
SDAGSSTIRRTGSGRSTLQAIGSAAAAGMVFYSISDVTDKLLNTSGDPIPMLQEDFWIST
ALVEPTAPLREVLEDLSPPAMAAFDLACSQCQLWKTCKQLLETAERRLNSSLERRGRRID
HVLLNADGIRGFPVVLQQISKSLNYLLMSASQTKSESVEEKGGGPPRCSITELLQMCWPS
LSEDCVASHTTLSQQLDQVLQSLREALELPEPRTPPLSSLVEQAAQKAPEAEAHPVQIQT
QLLQKNLGKQTPSGSRQMDYLGTFFSYCSTLAAVLLQSLSSEPDHVEVKVGNPFVLLQQS
SSQLVSHLLFERQVPPERLAALLAQENLSLSVPQVIVSCCCEPLALCSSRQSQQTSSLLT
RLGTLAQLHASHCLDDLPLSTPSSPRTTENPTLERKPYSSPRDSSLPALTSSALAFLKSR
SKLLATVACLGASPRLKVSKPSLSWKELRGRREVPLAAEQVARECERLLEQFPLFEAFLL
AAWEPLRGSLQQGQSLAVNLCGWASLSTVLLGLHSPIALDVLSEAFEESLVARDWSRALQ
LTEVYGRDVDDLSSIKDAVLSCAVACDKEGWQYLFPVKDASLRSRLALQFVDRWPLESCL
EILAYCISDTAVQEGLKCELQRKLAELQVYQKILGLQSPPVWCDWQTLRSCCVEDPSTVM
NMILEAQLLRRIPDPTMCLEVTEQSLDQHTSLATSHFLANYLTTHFYGQLTAVRHREIQA
LYVGSKVRIHREIQALYVGSKILLTLPEQHRASYSHLSSNPLFMLEQLLMNMKVDWATVA
VQTLQQLLVGQEIGFTMDEVDSLLSRYAEKALDFPYPQREKRSDSVIHLQEIVHQAADPE
TLPRSPSAEFSPAAPPGISSIHSPSLRERSFPPTQPSQEFVPPATPPARHQWVPDETESI
CMVCCREHFTMFNRRHHCRRCGRLVCSSCSTKKMVVEGCRENPARVCDQCYSYCNKDVPE
EPSEKPEALDSSKNESPPYSFVVRVPKADEVEWILDLKEEENELVRSEFYYEQCNNMGAK
PVNPLRQKIMNILGIAEGETRKAFVEEVAFKMSFGRMAPSASLCIAILNLHRDSIACGHQ
LIEHCCRLSKGLTNPEVDAGLLTDIMKQLLFSAKMMFVKAGQSQDLALCDSYISKVDVLN
ILVAAAYRHVPSLDQILQPAAVTRLRNQLLEAEYYQLGVEVSTKTGLDTTGAWHAWGMAC
LKAGNLTAAREKFSRCLKPPFDLNQLNHGSRLVQDVVEYLESTVRPFVSLQDDDYFATLR
ELEATLRTQSLSLAVIPEGKIMNNTYYQECLFYLHNYSTNLAIISFYVRHSCLREALLHL
LNKESPPEVFIEGIFQPSYKSGKLHTLENLLESIDPTLESWGKYLIAACQHLQKKNYYHI
LYELQQFMKDQVRAAMTCIRFFSHKAKSYTELGEKLSWLLKAKDHLKIYLQETSRSSGRK
KTTFFRKKMTAADVSRHMNTLQLQMEVTRFLHRCESAGTSQITTLPLPTLFGNNHMKMDV
ACKVMLGGKNVEDGFGIAFRVLQDFQLDAAMTYCRAARQLVEKEKYSEIQQLLKCVSESG
MAAKSDGDTILLNCLEAFKRIPPQELEGLIQAIHNDDNKLCILDLSVMDAFPLSLITDCQ
VRAYLICCKLRSAYLIAVKQEHSRATALVQQVQQAAKSSGDAVVQDICAQWLLTSHPRGA
HGPGSRK