GENSCAN 1.0	Date run: 15-Jan-104	Time: 07:39:27

Sequence ZFP36L1_1 : 7810 bp : 51.41% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1331   1387   57  1  0   68   98    88 0.977   9.06
ccggcccaccaaatctgaactttataaattgggctttgcgcgccccagcccggagtcaga
aaggcgaggggcgccgggaactggcgtgtgggactccagacaggagaggctgcgccttcc
ccgcaccgggaccttcgcgacacaccagatcctcgcccctggctcgcgcgaacgcacagg
ATGACCACCACCCTCGTGTCTGCCACCATCTTCGACTTGAGCGAAGTTTTATGCAAG
gtaaaggggggcggagcatttgcttttcaaaaagtctttttcttttgccttaagaaagaa
cccccaaaagtttgggtcttggaaggcaatggggaaagtggtgcagcgagatgattcttt
tctcctccggcatttctcccaagtttgaaggaatttggccccgtccttcccaccctttga

 1.02 Term +   3777   4736  960  2  0  136   46  1190 0.999 112.16
caaaataaacccaggtgaatggcctatgggagggagagagggaagggagcttgctagagc
cgaggtagagatgagttctttgagaaagagcgggcgtttgtgattgtgtagggggctgcc
catagtggacatcctggtggatgtcctctgtccttaccatcctttctcttctctctccag
GGTAACAAGATGCTCAACTATAGTGCTCCCAGTGCAGGGGGTTGCCTGCTGGACAGAAAG
GCAGTGGGCACCCCTGCTGGTGGGGGCTTCCCTCGGAGGCACTCAGTCACCCTGCCCAGC
TCCAAGTTCCACCAGAACCAGCTCCTCAGCAGCCTCAAGGGTGAGCCAGCCCCCGCTCTG
AGCTCGCGAGACAGCCGCTTCCGAGACCGCTCCTTCTCGGAAGGGGGCGAGCGGCTGCTG
CCCACCCAGAAGCAGCCCGGGGGCGGCCAGGTCAACTCCAGCCGCTACAAGACGGAGCTG
TGCCGCCCCTTTGAGGAAAACGGTGCCTGTAAGTACGGGGACAAGTGCCAGTTCGCACAC
GGCATCCACGAGCTCCGCAGCCTGACCCGCCACCCCAAGTACAAGACGGAGCTGTGCCGC
ACCTTCCACACCATCGGCTTTTGCCCCTACGGGCCCCGCTGCCACTTCATCCACAACGCT
GAAGAGCGCCGTGCCCTGGCCGGGGCCCGGGACCTCTCCGCTGACCGTCCCCGCCTCCAG
CATAGCTTTAGCTTTGCTGGGTTTCCCAGTGCCGCTGCCACCGCCGCTGCCACCGGGCTG
CTGGACAGCCCCACGTCCATCACCCCACCCCCTATTCTGAGCGCCGATGACCTCCTGGGC
TCACCTACCCTGCCCGATGGCACCAATAACCCTTTTGCCTTCTCCAGCCAGGAGCTGGCA
AGCCTCTTTGCCCCTAGCATGGGGCTGCCCGGGGGTGGCTCCCCGACCACCTTCCTCTTC
CGGCCCATGTCCGAGTCCCCTCACATGTTTGACTCTCCCCCCAGCCCTCAGGATTCTCTC
TCGGACCAGGAGGGCTACCTGAGCAGCTCCAGCAGCAGCCACAGTGGCTCAGACTCCCCG
ACCTTGGACAACTCAAGACGCCTGCCCATCTTCAGCAGACTTTCCATCTCAGATGACTAA

gccagggtagggagggacctcctgcctactccagcccctaccctgcacccacatcccata
ccctcttctccctacccatcccattccccacaggccctacattaacaaggttaagctcaa
cccctttcccccagcacctcagaatgtgccctccctctccccctcataaccccacctaac

 2.02 PlyA -   5923   5918    6                               1.05
 2.01 Term -   6686   6600   87  2  0  105   48    79 0.756   3.56

Predicted peptide sequence(s):


>ZFP36L1_1|GENSCAN_predicted_peptide_1|338_aa
MTTTLVSATIFDLSEVLCKGNKMLNYSAPSAGGCLLDRKAVGTPAGGGFPRRHSVTLPSS
KFHQNQLLSSLKGEPAPALSSRDSRFRDRSFSEGGERLLPTQKQPGGGQVNSSRYKTELC
RPFEENGACKYGDKCQFAHGIHELRSLTRHPKYKTELCRTFHTIGFCPYGPRCHFIHNAE
ERRALAGARDLSADRPRLQHSFSFAGFPSAAATAAATGLLDSPTSITPPPILSADDLLGS
PTLPDGTNNPFAFSSQELASLFAPSMGLPGGGSPTTFLFRPMSESPHMFDSPPSPQDSLS
DQEGYLSSSSSSHSGSDSPTLDNSRRLPIFSRLSISDD

>ZFP36L1_1|GENSCAN_predicted_peptide_2|28_aa
DLQGIQGENLTGKVKPKPSKTSSTINVS