GENSCAN 1.0	Date run: 15-Jan-104	Time: 06:50:49

Sequence TM9SF1_1 : 8614 bp : 53.03% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +   1512   1888  377  1  2   89   76   179 0.518  12.10
ggggtgaaccccaggttgggaggatgagagagcagaggtggagcggggtctttgggatag
agagacgtggggtagggtgaggcggggagggggccaatgggagcaagtggagccagggga
cctcagttcgaggcacctgacctggggtttctgtaacctccctggtttctataacctcag
GATTCCCCCAAACAGGTTCCACTGCCTTAAGGATGACAGTCGTAGGGAACCCTCGAAGTT
GGAGCTGCCAGTGGTTGCCAATCCTGATACTGTTGCTGGGCACAGGCCATGGGCCAGGGG
TGGAAGGCGTGACACACTACAAGGCCGGCGACCCTGTTATTCTGTATGTCAACAAAGTGG
GACCCTACCATAACCCTCAGGAAACTTACCACTACTATCAGCTTCCAGTCTGCTGCCCTG
AGAAGATACGTCACAAAAGCCTTAGCCTGGGTGAAGTGCTGGATGGGGACCGAATGGCTG
AGTCTTTGTATGAGATCCGCTTTCGGGAAAACGTGGAGAAGAGAATTCTGTGCCACATGC
AGCTCAGTTCTGCACAG
gtcagcctctccacattggctatcacgtagccctccttcccagagactaacagtgcctta
catttatggttcagggtacctttatggaaattgtctgatttgattctaactacaatacaa
cccagtgtggcaggcaggttaggtgatgctattctaattcagttgactaagatacatact

 1.02 Intr +   3294   3915  622  2  1   94   81   693 0.998  61.67
agttgcagtaagccgagatcgcaccactgcactccagcctgggtgacagagcaagactcc
atctcgaaaaaaaagaattatccaccccaaaatatcagtagtgctgaaggtgagaaactt
tgctgtaactctgcgcctggggagatcttgtgtgaccaactcctgacttgctctttatag
GTGGAGCAGCTGCGCCAGGCCATTGAAGAACTGTACTACTTTGAATTTGTGGTAGATGAC
TTGCCAATCCGGGGCTTTGTGGGCTACATGGAGGAGAGTGGTTTCCTGCCACACAGCCAC
AAGATAGGACTCTGGACCCATTTGGACTTCCACCTAGAATTCCATGGAGACCGAATTATA
TTTGCCAATGTTTCAGTGCGGGACGTCAAGCCCCACAGCTTGGATGGGTTACGACCTGAC
GAGTTCCTAGGCCTTACCCACACTTATAGCGTGCGCTGGTCTGAGACTTCAGTGGAGCGT
CGGAGTGACAGGCGCCGTGGTGACGATGGTGGTTTCTTTCCTCGAACACTGGAAATCCAT
TGGTTGTCCATCATCAACTCCATGGTGCTTGTGTTTTTACTGGTGGGTTTTGTGGCTGTC
ATTCTAATGCGTGTGCTTCGGAATGACCTGGCTCGGTACAACTTAGATGAGGAGACCACC
TCTGCAGGTTCTGGTGATGACTTTGACCAGGGTGACAATGGCTGGAAAATTATCCATACA
GATGTCTTCCGCTTCCCCCCATACCGTGGTCTGCTCTGTGCTGTGCTTGGCGTGGGTGCC
CAGTTCCTGGCCCTTGGCACTG
gtgaggtgataaaaatgaattggggatttatctcatgggatagaactaggtagggagttt
gttcagaaaaggtctgtggatcttctcttctatccagaggggcagacctaagggataggg
tggctctagcaagaatgcacgtattctattgtagattttctggatagcaaaactggggga

 1.03 Intr +   4207   4392  186  2  0   93   81   207 0.793  20.68
gggatagggtggctctagcaagaatgcacgtattctattgtagattttctggatagcaaa
actgggggagattgttttgctggaggccctgggtctgggagaaggggggctgattcctct
gaaattgctagaagagacacaggtgaggcctaacttgggctttccgctaccgtcctgcag
GCATTATTGTCATGGCACTGCTGGGCATGTTCAATGTGCACCGTCATGGGGCCATTAACT
CAGCAGCCATCTTGTTGTATGCCCTGACCTGCTGCATCTCTGGCTACGTGTCCAGCCACT
TCTACCGGCAGATTGGAGGCGAGCGTTGGGTGTGGAACATCATTCTCACCACCAGTCTCT
TCTCTG
gtgaggactttcctttccctggtgggcctttctggacttaggaatgaagaacacattgtg
gctggtcacagtggctcacacctgtaatcctagcactttgggagaccgaggccggaggat
cacttgagcccaaaagtttgagacaagcctagacaacatagtgagaccctctctctataa

 1.04 Intr +   5910   6183  274  1  1   72   68   294 0.985  22.94
gggacctgaaagggtggaggtgaaggcagtcgactctgcagggacatccaggagcatgag
tctgccgttagagtggcaggctgcttcagccccctccccttttggtcctggatgtaagtg
ggtgcccttagagatgtagctcctagtgttgaccctccctccgggggcccatccctgcag
TGCCTTTCTTCCTGACGTGGAGTGTGGTGAACTCAGTGCATTGGGCCAATGGTTCGACAC
AGGCTCTGCCAGCCACAACCATCCTGCTGCTTCTGACGGTTTGGCTGCTGGTGGGCTTTC
CCCTCACTGTCATTGGAGGCATCTTTGGGAAGAACAACGCCAGCCCCTTTGATGCACCCT
GTCGCACCAAGAACATCGCCCGGGAGATTCCACCCCAGCCCTGGTACAAGTCTACTGTCA
TCCACATGACTGTTGGAGGCTTCCTGCCTTTCAG
gtatcctccctttattccatggctattactgtcaggttcctgacctcaatttttcctgtc
cctactcatccagtaccctaacccaacccgttgatccctggttcagtggtaccattcaga
gatcattaaatggttcctcctatccccaagcaggactgagcttgaatgatatgagagtgt

 1.05 Intr +   6755   7117  363  2  0  126   33   352 0.036  28.36
cggctaatcataggcaaaaaatccccatgaagccaggagatctggggcagagagtggagt
gaactcacttttcacaatgacccagcaacatgggagagggtgggggctggatttcagccc
agccactgtgctgatggtgcacagccctttaatgctgtgtatcatctcttttcttcacag
TGCCATCTCTGTGGAGCTGTACTACATCTTTGCCACAGTATGGGGTCGGGAGCAGTACAC
TTTGTACGGCATCCTCTTCTTTGTCTTCGCCATCCTGCTGAGTGTGGGGGCTTGCATCTC
CATTGCACTCACCTACTTCCAGTTGTCTGGGGAGGATTACCGCTGGTGGTGGCGATCTGT
GCTGAGTGTTGGCTCCACCGGCCTCTTCATCTTCCTCTACTCAGTTTTCTATTATGCCCG
GCGCTCCAACATGTCTGGGGCAGTACAGACAGTAGAGTTCTTCGGCTACTCCTTACTCAC
TGGTTATGTCTTCTTCCTCATGCTGGGCACCATCTCCTTTTTTTCTTCCCTAAAGTTCAT
CCG
gtatatctatgttaacctcaagatggactgagttctgtatggcagaactattgctgttct
ctccctttcttcatgccctgttgaactctcctaccagcttctcttctgattgactgaatt
gtgtgatggcattgttgccttcccttttgccctttgggcattccttccccagagagggcc

 1.06 Intr +   7754   7844   91  2  1   51   63   173 0.029  11.60
gtcgggtttccgcgattcagccggtgctcagcctaacggaagtggaggagccggacctct
ttgtgggaagcgaattgaatcaccttggcaacccgcggggcgtgcagcaacgccctttcc
tccggaagtgggtgtcagaacctccacgtgctgtccctccccctccccttttcggcccag
TAGCGGCGGCTCAGTTGCTGCCATGGAGTCAGCCGGGCTAGAGCAGCTCCTACGGGAGCT
GCTGCTACCGGACACCGAGCGCATCCGTCGG
gtacggagcaggcgtaaccgggccagggcgagcgggaggttgcgggaaaggcccaactct
cacccctagcttccccccaggccacggaacagctccagatcgttcttcgggcccccgccg
ctttgccggctctctgcgacctgctagcctcggcggccgacccccaggtgagacccctga

 1.07 Intr +   7925   8011   87  1  0   49   94   118 0.989   9.16
tcggcccagtagcggcggctcagttgctgccatggagtcagccgggctagagcagctcct
acgggagctgctgctaccggacaccgagcgcatccgtcgggtacggagcaggcgtaaccg
ggccagggcgagcgggaggttgcgggaaaggcccaactctcacccctagcttccccccag
GCCACGGAACAGCTCCAGATCGTTCTTCGGGCCCCCGCCGCTTTGCCGGCTCTCTGCGAC
CTGCTAGCCTCGGCGGCCGACCCCCAG
gtgagacccctgactctcccctccgagcttcccactgtacgccaccggtcaagccccagt
attcgcccactgcggtccgctcagcaccttcctgcccggacccccacgtgcttgcttcct
cgtcctagatccgccagtttgcggccgtgctgacccgcagacgactgaacacccgctggc

 1.08 Intr +   8140   8219   80  0  2  114   64   173 0.997  16.34
cgccgctttgccggctctctgcgacctgctagcctcggcggccgacccccaggtgagacc
cctgactctcccctccgagcttcccactgtacgccaccggtcaagccccagtattcgccc
actgcggtccgctcagcaccttcctgcccggacccccacgtgcttgcttcctcgtcctag
ATCCGCCAGTTTGCGGCCGTGCTGACCCGCAGACGACTGAACACCCGCTGGCGACGGCTG
GCGGCGGAGCAACGGGAGAG
gtgggctgggcctggggtggggcggggccaggcggagacttttcttgggcaggctgggta
ccaaacacctgccacctgtgttccagcctcaagtccctgatcctgacggccctgcagaga
gaaacagagtaagtacctacccacttctctcgggatcttgacgactttgtctaggtttct

 1.09 Intr +   8306   8347   42  2  0   74   89    62 0.820   2.74
cttcctcgtcctagatccgccagtttgcggccgtgctgacccgcagacgactgaacaccc
gctggcgacggctggcggcggagcaacgggagaggtgggctgggcctggggtggggcggg
gccaggcggagacttttcttgggcaggctgggtaccaaacacctgccacctgtgttccag
CCTCAAGTCCCTGATCCTGACGGCCCTGCAGAGAGAAACAGA
gtaagtacctacccacttctctcgggatcttgacgactttgtctaggtttctgccttcct
tttcggctccaggctgggacttgtggggcagggacttcagttctagacgcaaggtggagt
gaggattttaaggctgttttgaagactaaagttcttgaggaagggtgatgatgatctgcc

Predicted peptide sequence(s):


>TM9SF1_1|GENSCAN_predicted_peptide_1|708_aa
XFPQTGSTALRMTVVGNPRSWSCQWLPILILLLGTGHGPGVEGVTHYKAGDPVILYVNKV
GPYHNPQETYHYYQLPVCCPEKIRHKSLSLGEVLDGDRMAESLYEIRFRENVEKRILCHM
QLSSAQVEQLRQAIEELYYFEFVVDDLPIRGFVGYMEESGFLPHSHKIGLWTHLDFHLEF
HGDRIIFANVSVRDVKPHSLDGLRPDEFLGLTHTYSVRWSETSVERRSDRRRGDDGGFFP
RTLEIHWLSIINSMVLVFLLVGFVAVILMRVLRNDLARYNLDEETTSAGSGDDFDQGDNG
WKIIHTDVFRFPPYRGLLCAVLGVGAQFLALGTGIIVMALLGMFNVHRHGAINSAAILLY
ALTCCISGYVSSHFYRQIGGERWVWNIILTTSLFSVPFFLTWSVVNSVHWANGSTQALPA
TTILLLLTVWLLVGFPLTVIGGIFGKNNASPFDAPCRTKNIAREIPPQPWYKSTVIHMTV
GGFLPFSAISVELYYIFATVWGREQYTLYGILFFVFAILLSVGACISIALTYFQLSGEDY
RWWWRSVLSVGSTGLFIFLYSVFYYARRSNMSGAVQTVEFFGYSLLTGYVFFLMLGTISF
FSSLKFIRSGGSVAAMESAGLEQLLRELLLPDTERIRRATEQLQIVLRAPAALPALCDLL
ASAADPQIRQFAAVLTRRRLNTRWRRLAAEQRESLKSLILTALQRETX