GENSCAN 1.0	Date run: 15-Jan-104	Time: 07:00:18

Sequence SRP54_1 : 48935 bp : 39.31% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +     61    178  118  2  1   60   98    99 0.400   6.70
ttccaagagatagtttattttttcccctcttttcccctccccactacactttccacttag
CCCTTTTTGAACTGCAAAATAACCTCTCAACTCCCCTCACCAGACCATTCTCTACAGAGC
AAATTCATCTACGAGATCCAAGACGCAACTCCCACCGCCAGGCGGTCGCCTCAGAAGG
gtaagcagaaagcatgcccacttggccacttttacaacttatttctgctcagaaatgcac
caactcaactacccggtagataaggcaccagctagcagagacctcttgctcatttcctct
tgtaccttataaaatgcccgcttttttgctccaaagacgaagcgggctggcttcagaaat

 1.02 Intr +    586    791  206  1  2   62   30   200 0.711   9.52
ctacgtgtggcgagcaactaactctcttttccgttagagcactcaaagccctggtcaatc
taccccccaagacagcagagaccagcacaacgatcccaaggaaggctgttggcttcaccc
cgcttaagtcctcaaagtcagcgcctgcagcatatccttgcccccaccacctgcctctag
CTCTGGTCACTTACACTTACGGTTAGTTCGCATCCACTGTAACAGCGCCTGGCGGTCGGC
AGGAGCCACAGTGCGAAGCGGCCGCAGCATCACTGCCTGCCTCGCAGTGGGAAATTTTAC
CTTGCTGGAGCAAGCCGCGCAGGCACTGGCTGGCATTGCGCATGCGCAAGCAGAGACCGC
CCCACCCTCCGCGGAACAAGCCTCCG
gtctgcaaagccctaagccccgcccctctacggaggtctcacgtgcgcctggggatccct
gccttcagtcacacctctatctctcatctttccgctcttagctgggagtgctccgcctag
tcacttttcttaaggtggctcgtcgaggcctgacttcttccccgaaatcacgtccctaga

 1.03 Intr +   1306   1391   86  2  2   73  115    60 0.764   5.82
cctatagaaaggctggactacgcggagtggtgacgtttcctcattgggcggaaggttcgc
tggcactccgttggtcttccagctggtgggagttgacgacgtggtgctgggcgttgggac
cctactttatctagttcgggaagttgggttgtggggtcatacctgtctgtctgctcccag
CTTTCTTGGGTTTCTTCCGACGGCGTGGGGCCTCGCTAAGGAATTCCCGGCCCCTCAGGG
CCACGGCTTTAGCGGTGTCTTTTGCG
gtaagtgtctgctttttcccgccccagactacggagggggagcgaggggcagccccagcg
ctgctcaggaggcgagagactccgggggaagtcggcctccgtggccaccggccatcgtta
ccgagactgagtttctgtggctctttatctcgtcttccatgagaagttttattaaagatg

 1.04 Intr +  17734  17825   92  0  2  114   97    95 0.894  10.87
ggtctcttattttgacaaaatgactaaacatttaataaaattatctctccaagaactaac
tgaaaaacccagtagtgtggtattactaagctgtggttatgtaagtgatcaacaattgtt
tttatggaactgaaatgaaacattgggtgctttaaatttcatttatttctttattttcag
GTATTGAATGCTATGCTAAAAGAAGTCTGTACCGCTTTGTTGGAAGCAGATGTTAATATT
AAACTAGTGAAGCAACTAAGAGAAAATGTTAA
gtaagttaaatcaatcaggtaaaacacaggcacagtttagtttagtttactggaaagagg
tgctaactggaagtgtttgctgtatcaggaatcatttctgctctgcaccactggaaaagt
gctgtgttggagctcatatgttgggcgagagcatgtgtagtacgtttccataatgatggt

 1.05 Intr +  29685  29835  151  0  1   50   92   166 0.825  12.44
atgcttcatgcttttttagaagtagattctgtatttaatactttatagattttcctcttc
taaattgaaattggggtcattttggctttttcaaaatagattataggtaaattaactttc
cgaattagtagtatttggaagttttgtcgttttgttaaatcatttgtccatgttatatag
CTATACAGAAATGGATCCTGTCATCATTGCTTCTGAAGGAGTAGAGAAATTTAAAAATGA
AAATTTTGAAATTATTATTGTTGATACAAGTGGCCGCCACAAACAAGAAGACTCTTTGTT
TGAAGAAATGCTTCAAGTTGCTAATGCTATA
gtaagtagctttcaatgtaacactattattaggactttggttaatttaattataaaacca
ggttgagtatatgaccaatataaattattctttgcctgtgaggcagatccccagtaattt
atttttgttttgggcacctatatctatgtggtagggacttaatttcattatttttgttct

 1.06 Intr +  31522  31670  149  0  2   44   85   139 0.803   7.31
ccaggctggtcttgaactatctcaggtgatccacctggctcggcctcccaaagtgctggg
attacaggcatgagccactgcacctggctctaaatattgttttatagcttctaatgatga
catttgcttaggatcaataaaaatcttttctaaagtatcttttctatttaaactttctag
CAACCTGATAACATTGTTTATGTGATGGATGCCTCCATTGGGCAGGCTTGTGAAGCCCAG
GCTAAGGCTTTTAAAGATAAAGTAGATGTAGCCTCAGTAATAGTGACAAAACTTGATGGC
CATGCAAAAGGAGGTGGTGCACTCAGTGC
gtaagtatcattgatactgttgtcctctgtcttgggattatatggggaaggatatgtgtt
tatagctttcatattgatcatttaaaatatgtttcaatagtgagcctaatatggtttata
aagaaagtttaaatagaaacaattttggagcctgtctgatataggtctattataacttgt

 1.07 Intr +  31978  32078  101  1  2  108   76    46 0.963   4.23
tttaaatagaaacaattttggagcctgtctgatataggtctattataacttgtgaaatga
aacttgagttttgtacctttgtctaattagctttggaggcggattcacttcgaatttcag
atctgctggaaatttgtggggttcttttgaggttattttatattttctttttttttccag
AGTCGCTGCCACAAAAAGTCCGATTATTTTCATTGGTACAGGGGAACATATAGATGACTT
TGAACCTTTCAAAACACAGCCTTTTATTAGCAAACTTCTTG
gtatgtacagtggtggggatatagaaaaatctccaagaaatacgatgtatctttaggaca
aaataggattttaattctgtcctcactaatttaagcacatcatttctttctgtgacttag
tttccttacctgtaaaatagagataatggttatctgccctctgtggtgaaagtggtaaaa

 1.08 Intr +  32920  33006   87  2  0  113   31   113 0.724   7.12
gccaccgctcctggccatgccacttaactttcttagctttggttttctcatttgtgtagt
gtagtaagaatacctaacctattataacctcacaaggttattatgtatgtgaatgtgttt
tgtataatgtgaagcagggtatagtattagttgttaatttttcttttttgtatcttatag
GTATGGGCGACATTGAAGGACTGATAGATAAAGTCAACGAGTTGAAGTTGGATGACAATG
AAGCACTTATAGAGAAGTTGAAACATG
gtatatgagtgacaaaaaagcacttcatctcagatttcttccattgattttttttataaa
gttactattaagttatttgaaatgtaatatctgttagagtcagatcttccactgcttatt
attttagatgatttatatgcaaatcatttaaaatctcaggtacctgagcagttacagaat

 1.09 Intr +  37167  37250   84  1  0   26  116    53 0.250   0.77
ttttctaaaatagatacacttgctttaattatttttacattcgggtaaaaatatatctaa
gacttagtgtcaatattaaacctaatagttaaatgtggacattttgaaccattaatctta
agctactattgactttatgtttaaatctgttgtaggggatgatccctggttttgggacag
ATTTTATGAGCAAAGGAAATGAACAGGAGTCAATGGCAAGGCTAAAGAAATTAATGACAA
TAATGGATAGTATGAATGATCAAG
gtaagatggcagattattttcctcaggcaaaaatgttctgagtatcagtaagatgagagt
ttcactgtattcttgtggacaagatggggagaaatttagcctgaaagattatttttaggt
agatttgtaatagcttgaaagctcttactcaaagggttatgattattggattgccttcat

 1.10 Intr +  41086  41256  171  2  0   44  116   134 0.942  10.79
ctatgtattatgtctgtttttctgtatgtaagatattttgtaatataaaaagaaaaatga
gatagttatcactttaaaaacatctgctaagctctttgaagttatatattgcccatttgc
acataactgctttgatggtgaatgataattgtgtgtgagagtaactgaccttgtctacag
AACTAGACAGTACGGATGGTGCCAAAGTTTTTAGTAAACAACCAGGAAGAATCCAAAGAG
TAGCAAGAGGATCGGGTGTATCAACAAGAGATGTTCAAGAACTTTTGACACAATATACCA
AGTTTGCACAGATGGTAAAAAAGATGGGAGGTATCAAAGGACTTTTCAAAG
gtaagaaaaataagcttgttattagttaacagacggaaaagaaaggaagttgagaaaaaa
gagtgctgccagtattggaaaattcacagctgaatttcatgttattttcaagtacttcca
ggatttatgtgacctgtgatttatctgttttcatattcaaggtaatattaatatttaaaa

 1.11 Term +  46264  46388  125  2  2  130   38    48 0.690   1.57
gtaattgagaaaaagattagaagggaatatgtagaaatagaaagaattatgttagagtga
taggattatgtaattttttcttagtattttctcagttcatcaaactttctattataccct
gattatactgattatattacctcctacgctgactcaaaatctttttttttttcccctcag
GTGGCGACATGTCTAAGAATGTGAGCCAGTCACAGATGGCAAAATTGAACCAACAAATGG
CCAAAATGATGGATCCTAGGGTTCTTCATCACATGGGTAAATACCAAGTTGTTGGCAGTT
GCTAA
tgcagtttaatttataagggttgagttttaatgataagccttttattgtaatattatgaa
aatatgttcaaaaggtgtgtgatttcagggaaatggtcatctgaatcctaagttgaattc
aattgtaatagggcttattagctgaggtcttattcactcctctgctgccatctgtgtgat

Predicted peptide sequence(s):


>SRP54_1|GENSCAN_predicted_peptide_1|456_aa
XLFELQNNLSTPLTRPFSTEQIHLRDPRRNSHRQAVASEGSGHLHLRLVRIHCNSAWRSA
GATVRSGRSITACLAVGNFTLLEQAAQALAGIAHAQAETAPPSAEQASAFLGFFRRRGAS
LRNSRPLRATALAVSFAVLNAMLKEVCTALLEADVNIKLVKQLRENVNYTEMDPVIIASE
GVEKFKNENFEIIIVDTSGRHKQEDSLFEEMLQVANAIQPDNIVYVMDASIGQACEAQAK
AFKDKVDVASVIVTKLDGHAKGGGALSAVAATKSPIIFIGTGEHIDDFEPFKTQPFISKL
LGMGDIEGLIDKVNELKLDDNEALIEKLKHDFMSKGNEQESMARLKKLMTIMDSMNDQEL
DSTDGAKVFSKQPGRIQRVARGSGVSTRDVQELLTQYTKFAQMVKKMGGIKGLFKGGDMS
KNVSQSQMAKLNQQMAKMMDPRVLHHMGKYQVVGSC