GENSCAN 1.0	Date run: 15-Jan-104	Time: 06:58:17

Sequence SNX6_1 : 71119 bp : 44.51% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1180   1221   42  0  0   64   64    83 0.545   2.02
cttcaggctctcccgacttcggtgccttgaccttgggcagaaggccctgttaaccttcct
cgctcacggactcgagcgaccagcgccggggacggggcgggccgtccttaggccccgccc
cttcgcctccgccccgccccgccccgctcctggccgccggctccctccggcagcagggag
ATGCGCGCCTGCGCCGGCCCTCGCCTCGGAGCAGCCATGATG
gtgggtgttctccgcggcgccgagtcccgggagcgcggtgggggcagcgggcgcggggcg
ggcgcggggaccgcgccagcctgtcactaatgtctccctttgtgtctcccccatctcatc
cttttccccggcgcgccgtgcccgccgaccccacaggaaggcctggacgacggcccggac

 1.02 Intr +   1378   1425   48  0  0   58   83   118 0.860   7.18
cctcgcctcggagcagccatgatggtgggtgttctccgcggcgccgagtcccgggagcgc
ggtgggggcagcgggcgcggggcgggcgcggggaccgcgccagcctgtcactaatgtctc
cctttgtgtctcccccatctcatccttttccccggcgcgccgtgcccgccgaccccacag
GAAGGCCTGGACGACGGCCCGGACTTCCTCTCAGAAGAGGACCGCGGA
gtaagttctgccttcctttcgctcgcgggaccctggaccctccttccccatcctgggtcc
ccgggtgtggtacggggatgggtccccagccgcgcggcactccctccccgtagtcctcct
ttcggtttcctcgctgcaccgcgccccaccctcccgcagcccttcctccctaggggccgc

 1.03 Intr +  21590  21694  105  1  0   70   94    83 0.982   7.51
tagcgttgcccaaagcagctgcttcaaaatgtatatagtatgtatgttaaatggacatga
gtacctctttagacttaataatcttttgttatttttgttttgtttttgcattgtcttaag
agaaaaaatgaaattatataaaacatgattttcatgaagatactggttttctttttctag
CTTAAAGCAATAAATGTAGATCTTCAAAGTGATGCTGCTCTGCAGGTGGACATTTCTGAT
GCTCTTAGTGAGCGGGATAAAGTAAAATTCACTGTTCACACAAAG
gtaaatgtgattttgtactttctattattttagccatttattatactacatatgtgatat
gttgaccagacttgggttttaaacataattggaaagaaactattttaacaaaaatagatg
taggaaaatgtacttttttttttttttttttttttttgagacggagtcttgctctgtcgc

 1.04 Intr +  23192  23302  111  1  0   64   97    75 0.989   6.58
ggtgtagtcccagctactcggaggctgaggtgggaggattgcttgagcctgggaggttga
ggctgcagtgagccgagattgttcgactgcactccagcctggtggcagagcaagacccag
tttcaaaaaactttttagtgtaaatttgatttttattcaagaaaatctctatctttacag
AGTTCATTGCCAAATTTTAAACAAAACGAGTTTTCAGTTGTTCGGCAACATGAGGAATTT
ATCTGGCTTCATGATTCCTTTGTTGAAAATGAAGACTATGCAGGTTATATC
gtaagtattgagactccattttaattccattttctaggaggttttaggtacttcgttatg
ttttggaatcttgtttagcattttttgtgaactgtttttttgttttgttttgttttgttt
ttgagatggagtctcactctgttgcccaggctggagtgtagtgacgcagtctcggctcac

 1.05 Intr +  25615  25736  122  0  2   75   94   107 0.996   9.29
ctggccaaaacttaatttctacaactagtcaagttctccaatctgaatttgggtgttcct
ggtgttcagctcattctggatccccttagctttcccagacacagtcttctatggtggcag
tagtacaatgcttcaagaaatgaaaatttccttaaaattagtcatttggtcctgttacag
ATTCCACCAGCACCACCAAGACCTGATTTTGATGCTTCAAGGGAAAAACTACAGAAGCTT
GGTGAAGGAGAAGGGTCAATGACGAAGGAAGAATTCACAAAGATGAAACAGGAACTGGAA
GC
gtaagtgatttttttatttttttgttttttttttttggttgttgttgcctttgttaattg
tgcttgctttaatgccttttttggtgttttctgatatcccatcattaaaccctttctgga
agatgcaggtttaagtcatacaaccagtattaatgatcatgatcagagcctacaggaaaa

 1.06 Intr +  27861  27984  124  0  1   62   76    60 0.980   2.79
aagctgggttttatgtatttcattaacagttcaactaaaaaccttgtttacatgaattat
atctttgtatctctgatttgcattcggaataatccaaagagtattttctgaaaaaaattg
ttgcaggtgactttttagttgatggagttttttacctttaattttgtatattgtttctag
TGAATATTTGGCAATATTCAAGAAGACAGTTGCGATGCATGAAGTGTTCCTGTGTCGTGT
GGCAGCACATCCTATTTTGAGAAGAGATTTAAATTTCCATGTCTTCTTGGAATATAATCA
AGAT
gtgagtatcacattgattggtggtcaagttttctttttcttcttcttcttcttttttttt
ttgagacggaatctcgctctgtcttccaggctggagtacagtggcatagtggcatgatct
tggctcactgcaagctccgcctcccgggttcatgccattctcctgcctcagcctccctag

 1.07 Intr +  33687  33782   96  2  0   62  116    27 0.858   3.11
ttaccaaactccttttttatgccctaaaatttgaaaatcattgatgtgcatgatgaaatt
tccactttattaagattaaaaactaggatccttttgagattgccatttaaatatcaaaga
ataaaggaggcactgctttccatttgtaaccttaaaaatgttaaattacctttctttcag
TTGAGTGTGCGAGGAAAAAATAAAAAAGAGAAACTTGAAGACTTCTTTAAAAACATGGTT
AAATCAGCAGATGGAGTAATCGTTTCAGGAGTAAAG
gtaagattttatttgattaactgtggtattagttgagacttcttttaaaagggagataga
ttgagatttcaaatgtgcagaattagagtaaaagacatttggacggttagaatcttcagt
cctaggaacaggaggaatcctcctgacctagattcctctctttagagcgttcccttctgc

 1.08 Intr +  38182  38287  106  0  1   75   69    75 0.930   4.09
cttgatagatagaaatgcatgtctattaaagtcttgttggtgaaattagtataataacat
ctgactgaggataggtatgctattttactgatgatcttttatatttataatgatagttat
ttacatataaaactaaagcaaataagtgaaaaaagtttatattttcttttgatcttatag
GATGTAGATGATTTCTTTGAGCACGAACGAACATTTCTTTTGGAGTATCATAACCGAGTT
AAGGATGCATCTGCTAAATCTGATAGAATGACAAGATCCCACAAAA
gtaagatttttctgtggctaaagcttatatcttttaatggaataattataaagttcatat
tatagtttgaaaaagtcttaatatagagcagtagttctcaaactggtctgttggagccta
ggctccatggcccttttatagtgagcctgtgaggtcaaaactattttcagctgggcacag

 1.09 Term +  62183  62643  461  0  2   67   42   428 0.017  31.35
tgggcatggggtttctttttgggtgatgaaagtgttctaaaatcgattatggtgatcctc
agttctgtgagcttgctaaaaaccattgaattacatattttaaattgtgagttatgtggt
acatggactatcaagctgttacttaaaaaaacggactgagccctttcccctggctggcag
TGCACAGGCCGGGCCGCATGATGCCTGGAGTTACTGTAAAAGATGTGAACCAGCAGGAGT
TCATCAGAGCTCTGGCAGCCTTCCTCAGAAAGTCTGGGAAGCTGAAAGTCCCCGAATGGG
TGGACACCGTCAAGCTGCTGGCCAAGCACAAAGAGCTTGCTCCCTACGATGAGAACTGGT
TGTACACGCGAGCTGCTTCCACAGCGTGGCACCTGTACCTCTGGGGTGGCGCTGGGGTTG
GCTCCATGACCAAGATCTATGGGGGATGTCAGAGAAGTGGCGGCATGCCTGGCCACTTTA
GCCGAGGCTCCAAGAATGTGGCCCACCGGGTCCTCCAAGCCCTGGAGGGGCTAAAAATGG
TGGAAAAGGACCAAGATGGGGGCCGCAAACTGACACGTCAGGGACAGAGAGATCTGGACA
GAATCGCTGGACAGGTGGCAGTTGCCAACAAGAAGCATTAG
aacaaaccatgctgggttaataaattgcctcattcgttaaaaaaaaaaaaaaaacaggct
gagtgcagtggctcacgcttgtaatccactttagcaggctgaaatagggggatcactttg
aggccaggagtttgagacctgcctgggcaacatagtgaggccccgtctctacaaaaatct

 2.02 PlyA -  64415  64410    6                               1.05
 2.01 Term -  69804  69608  197  1  2   23   47   159 0.695   2.87

Predicted peptide sequence(s):


>SNX6_1|GENSCAN_predicted_peptide_1|404_aa
MRACAGPRLGAAMMEGLDDGPDFLSEEDRGLKAINVDLQSDAALQVDISDALSERDKVKF
TVHTKSSLPNFKQNEFSVVRQHEEFIWLHDSFVENEDYAGYIIPPAPPRPDFDASREKLQ
KLGEGEGSMTKEEFTKMKQELEAEYLAIFKKTVAMHEVFLCRVAAHPILRRDLNFHVFLE
YNQDLSVRGKNKKEKLEDFFKNMVKSADGVIVSGVKDVDDFFEHERTFLLEYHNRVKDAS
AKSDRMTRSHKMHRPGRMMPGVTVKDVNQQEFIRALAAFLRKSGKLKVPEWVDTVKLLAK
HKELAPYDENWLYTRAASTAWHLYLWGGAGVGSMTKIYGGCQRSGGMPGHFSRGSKNVAH
RVLQALEGLKMVEKDQDGGRKLTRQGQRDLDRIAGQVAVANKKH

>SNX6_1|GENSCAN_predicted_peptide_2|65_aa
XQQMKGLDLDPEARALGPAFIHWWTSHGLIFTSEGYVKDKTHSASNGNSTVQTALGNMSV
KETKR