GENSCAN 1.0	Date run: 15-Jan-104	Time: 07:28:36

Sequence SIX6_1 : 4903 bp : 51.85% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +   1048   1867  820  2  1   14   67  1059 0.413  87.55
acctccaggttctgcaaaatactgaagaaaagtccaggagctaacggcgggcgctgtcga
gcacggggaggtgctgaaatagtcctggcgtgctgattcaagctttgattggcagagcca
cccggtgactgacagggggtctccatggcgcccgcgccgccaatccgcccaccccaatag
CGGAGCCAGCTCGCCTGCCGGCGTGCCTGAGCCGAGCCGAGCCCGAACCCCAAGCCGCGG
AGCCAGCACCTCCTCCAGTCGGGGTCGTCCGCTCCCGGCCGTTGAGCCACCGCCGCCACC
CGGTAGTGTGTCCCGCTGCCCCAATCCGCCTCATCAACAAGCGCCTGGCACACTCAGCCA
GGCCCGCGGGCATCTGCTGCGTGTCCCGCTCCGGGCTCAGTGCCCTCGCCGCCGCCGGCA
CTGCCTCGATGTTCCAGCTGCCCATCTTGAATTTCAGCCCCCAGCAAGTGGCCGGGGTAT
GTGAGACCCTGGAAGAGAGCGGCGATGTGGAGCGCCTGGGTCGCTTCCTCTGGTCGCTGC
CCGTGGCCCCTGCGGCCTGCGAGGCCCTCAACAAGAATGAGTCGGTGCTACGCGCACGAG
CCATCGTGGCCTTTCACGGTGGCAACTACCGCGAGCTCTATCATATCCTGGAAAACCACA
AGTTCACCAAGGAGTCGCACGCCAAGCTGCAGGCGCTGTGGCTTGAAGCACACTACCAGG
AGGCTGAGAAGCTGCGTGGAAGACCCCTGGGACCTGTGGACAAGTACCGAGTAAGGAAGA
AGTTCCCGCTGCCGCGCACCATTTGGGACGGCGAACAGAAGACACACTGCTTCAAGGAGC
GCACGCGGCACCTGCTACGCGAGTGGTACCTGCAGGATCCATACCCTAACCCCAGCAAAA
AACGTGAGCTCGCCCAGGCAACCGGACTGACCCCTACGCAGGTGGGCAACTGGTTCAAAA
ACCGCCGACAAAGGGACCGAGCGGCTGCAGCCAAGAACAG
gtcggtacctagaggcctccgcgctttgagcgcaccggggaggaggcgggtggaggcacc
tctggcgcccttacccagtccctggcgactccaattcagcaggagttgggagcgcggtct
gtcttgggttaagagccctgcgttctgggctcctggccgggagttcccttgccggctctg

 1.02 Term +   2981   3149  169  2  1  129   44   208 0.999  18.17
aggggcggccgcggactcctgcccgacctctgtcgccttgccgagtaatcctcgccttaa
ctgctggggtcttcggaagaacctctagccgccgggctggagggacgcaggaggtggtgg
gggcgggcgacgggcggctgtgttacgagctgtgacccgtgttccctttcttccccgtag
ACTCCAGCAGCAGGTCCTGTCACAGGGTTCCGGGCGGGCACTACGGGCGGAGGGCGACGG
CACGCCAGAGGTGCTGGGCGTCGCCACCAGCCCGGCCGCCAGTCTATCCAGCAAGGCGGC
CACTTCAGCCATCTCCATCACGTCCAGCGACAGCGAGTGCGACATCTGA
gttgcccatccaggatgctcagaagcagattccagtgtaaaaacgagaaaaacaaaatga
aagaggggaagaagatgagagacctgcaaatccagcgccacagaagccaggtgaccaggg
acccgcgggctcgggttgccgtttcccgccccaccccgcggccggcctggcttcactggc

Predicted peptide sequence(s):


>SIX6_1|GENSCAN_predicted_peptide_1|329_aa
XEPARLPACLSRAEPEPQAAEPAPPPVGVVRSRPLSHRRHPVVCPAAPIRLINKRLAHSA
RPAGICCVSRSGLSALAAAGTASMFQLPILNFSPQQVAGVCETLEESGDVERLGRFLWSL
PVAPAACEALNKNESVLRARAIVAFHGGNYRELYHILENHKFTKESHAKLQALWLEAHYQ
EAEKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRHLLREWYLQDPYPNPSK
KRELAQATGLTPTQVGNWFKNRRQRDRAAAAKNRLQQQVLSQGSGRALRAEGDGTPEVLG
VATSPAASLSSKAATSAISITSSDSECDI