GENSCAN 1.0	Date run: 15-Jan-104	Time: 07:28:42

Sequence SIX4_1 : 13004 bp : 45.60% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1201   2000  800  0  2   35  105  1310 0.714 119.59
gggctttccggagggggagaggagggagggagacgaaggaggaggagtaagagaggagga
aagaaagaggaaaagagtgcgagggagtgagggagggaggaaaataaacaacaaaaaatg
tcctcttcctcccccaccgggcagatcgcaagtgcggcggacatcaagcaagagaatggg
ATGGAAAGCGCCTCGGAAGGGCAGGAGGCGCACCGAGAAGTGGCGGGGGGCGCGGCGGTA
GGGCTGAGCCCCCCGGCTCCAGCCCCTTTTCCCCTGGAGCCGGGGGACGCCGCGACCGCT
GCCGCCAGGGTGAGCGGAGAGGAAGGGGCAGTGGCGGCGGCGGCGGCCGGAGCGGCGGCG
GATCAGGTACAACTCCACTCGGAACTTCTGGGCAGGCACCACCACGCCGCCGCCGCCGCC
GCGCAGACCCCGCTGGCCTTCTCGCCCGACCACGTCGCCTGCGTGTGCGAGGCACTGCAG
CAGGGGGGCAACCTGGACCGCCTGGCCCGGTTCCTGTGGTCCCTGCCCCAGAGCGACCTG
CTACGTGGCAACGAGAGCCTGCTGAAGGCGCGGGCGCTCGTGGCCTTCCACCAGGGCATC
TACCCCGAGCTCTACAGCATCCTCGAGAGCCACAGCTTCGAGTCGGCCAACCACCCGCTG
CTGCAGCAGCTCTGGTACAAGGCGCGCTACACCGAGGCCGAGCGAGCCCGCGGCCGGCCG
CTGGGAGCCGTAGACAAGTACCGGCTGCGCAGGAAATTCCCCCTGCCCCGCACCATCTGG
GACGGCGAGGAGACGGTGTATTGTTTCAAGGAGAAGTCGCGCAACGCGCTCAAGGAGCTC
TACAAGCAGAATCGCTACCCTTCGCCCGCCGAGAAGCGGCACCTGGCCAAGATCACCGGC
CTCTCCCTCACCCAGGTCAGCAACTGGTTCAAGAACCGCCGGCAGCGCGACAGGAACCCC
TCCGAGACCCAGTCCAAAAG
gtgagcgccaactttcctcctcctcccccttcctctcccccacccccttcccggctttct
tttcctccaagtgctcgcaaacatggcgcttaccttccccaccagcctggtccggctgcc
cacctctccccgccccctacctcgctccccggccggcagaggtagggggcggcggaggcg

 1.02 Intr +   4767   5506  740  0  2   80   87   262 0.434  16.39
ctggctggtcggaatctgctgaaaggcctcttagtttaaataggactagcagatatcctg
ctgtgctttccttaaatactgcctttaatggatttagaagctggttttccaaacaagtgg
cactgtgtagaatgtcatccccctgaccttctgaacattttgatttccccctccatacag
TGAGTCAGATGGCAACCCCAGCACTGAAGATGAATCCAGCAAGGGACATGAGGATTTATC
TCCTCACCCACTCTCCAGTTCATCTGATGGCATCACCAACCTCAGCCTTTCCAGTCATAT
GGAGCCAGTATATATGCAACAAATTGGAAATGCTAAGATATCATTAAGCTCTTCTGGAGT
TCTGTTGAATGGAAGCTTGGTACCTGCAAGTACTTCACCTGTCTTCCTTAATGGAAATTC
TTTTATTCAGGGACCCAGTGGAGTTATCCTTAATGGATTAAATGTGGGAAATACACAGGC
AGTGGCATTGAACCCACCAAAAATGTCATCAAACATTGTGAGCAATGGTATATCCATGAC
TGACATACTGGGGTCTACTTCCCAGGACGTGAAGGAATTCAAAGTCCTCCAGAGTTCTGC
TAACTCAGCAACCACCACGTCCTACAGCCCCAGTGTCCCTGTCTCATTCCCAGGCCTGAT
ACCCAGCACTGAGGTGAAAAGAGAAGGCATTCAAACAGTGGCTTCCCAAGATGGAGGGTC
TGTAGTGACTTTTACTACACCAGTGCAAATTAACCAGTATGGCATTGTCCAGATCCCCAA
TTCCGGAGCAAACAGCCAGTTCCTTAATGGGAGCATTGGATTCTCTCCACTGCAGCTGCC
CCCTGTGTCAGTGGCAGCTTCACAAGGTAACAATCTCATTTGGTACCTTAATGCACCAGC
AAATGTGTTCATCAGCTGCT
gtaagtgacgcatttggtgatagctatagattgatgtttctgttcaggtaccttattagc
tgccgaagctgtagagtagccttgatgtgattctcctctttcacaatacccatgtcatat
ccaggttgctttattcccttgcatcatgaggatgggcttttattttactaacaactgaat

 1.03 Term +  11009  11805  797  0  2  100   43   267 0.401  16.85
agagcctgggaatctgtagttttaggtgcccaaggtaattctgaaccagaattgggctaa
atgattgtatggaagtgttgcttctttatagatactgtacctgagaaaaaaacgtgtgtg
taactttttttctttccctctcacttccatcagtgataatcagtactttattttttttag
GTAATATCTCAGTAAGCTCAAGCACTTCAGATGGAAGCACATTTACAAGTGAGTCTACCA
CAGTCCAGCAAGGAAAGGTTTTCTTGAGCTCTCTTGCTCCCAGTGCAGTGGTATACACGG
TTCCTAATACAGGCCAGACTATAGGATCTGTGAAACAGGAAGGCTTGGAAAGGAGCCTGG
TATTTTCTCAGTTGATGCCTGTCAATCAGAATGCACAAGTAAATGCAAACCTGTCTTCTG
AAAACATCTCGGGGAGTGGCCTGCATCCACTGGCCTCCTCATTAGTTAATGTATCTCCAA
CTCACAATTTTTCTCTCAGTCCCTCTACACTACTAAATCCCACTGAGCTAAACCGCGACA
TTGCCGATAGCCAACCAATGTCTGCACCGGTGGCAAGCAAATCTACTGTGACATCTGTCA
GCAACACTAACTATGCAACTCTTCAGAACTGCTCCCTTATTACTGGTCAAGACCTATTGT
CAGTCCCTATGACTCAGGCTGCCCTTGGGGAAATAGTTCCTACAGCTGAAGATCAGGTAG
GTCACCCCTCCCCAGCAGTACATCAGGATTTTGTCCAAGAACATCGTTTGGTTCTGCAAT
CGGTAGCTAACATGAAAGAGAATTTCTTATCAAATTCTGAGAGCAAAGCAACAAGTAGCT
TAATGATGCTGGACTCTAAATCCAAGTATGTCTTAGATGGCATGGTTGATACTGTCTGTG
AAGACCTGGAAACAGACAAAAAAGAGCTTGCCAAGCTCCAGACTGTCCAGCTGGATGAAG
ATATGCAAGACTTATGA
actttatttcctcctcacctctttttggcatcagcggcaaatcttttcatgaagccccaa
ggacacaaaacattttcccatttaaaggaaaacactctagttttgcaagtatatgcatac
aagagactttagattgatctgcatgaagatcacagttaagtatacaggagtagaactgca

Predicted peptide sequence(s):


>SIX4_1|GENSCAN_predicted_peptide_1|778_aa
MESASEGQEAHREVAGGAAVGLSPPAPAPFPLEPGDAATAAARVSGEEGAVAAAAAGAAA
DQVQLHSELLGRHHHAAAAAAQTPLAFSPDHVACVCEALQQGGNLDRLARFLWSLPQSDL
LRGNESLLKARALVAFHQGIYPELYSILESHSFESANHPLLQQLWYKARYTEAERARGRP
LGAVDKYRLRRKFPLPRTIWDGEETVYCFKEKSRNALKELYKQNRYPSPAEKRHLAKITG
LSLTQVSNWFKNRRQRDRNPSETQSKSESDGNPSTEDESSKGHEDLSPHPLSSSSDGITN
LSLSSHMEPVYMQQIGNAKISLSSSGVLLNGSLVPASTSPVFLNGNSFIQGPSGVILNGL
NVGNTQAVALNPPKMSSNIVSNGISMTDILGSTSQDVKEFKVLQSSANSATTTSYSPSVP
VSFPGLIPSTEVKREGIQTVASQDGGSVVTFTTPVQINQYGIVQIPNSGANSQFLNGSIG
FSPLQLPPVSVAASQGNNLIWYLNAPANVFISCCNISVSSSTSDGSTFTSESTTVQQGKV
FLSSLAPSAVVYTVPNTGQTIGSVKQEGLERSLVFSQLMPVNQNAQVNANLSSENISGSG
LHPLASSLVNVSPTHNFSLSPSTLLNPTELNRDIADSQPMSAPVASKSTVTSVSNTNYAT
LQNCSLITGQDLLSVPMTQAALGEIVPTAEDQVGHPSPAVHQDFVQEHRLVLQSVANMKE
NFLSNSESKATSSLMMLDSKSKYVLDGMVDTVCEDLETDKKELAKLQTVQLDEDMQDL