GENSCAN 1.0	Date run: 15-Jan-104	Time: 07:28:39

Sequence SIX1_1 : 5827 bp : 51.38% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1474   2033  560  0  2   85  107   924 0.672  88.53
ctccgccttctcttccttggccgcccaccgccaagttccgactccggttttcgcctttgc
aaagcctaaggaggaggttaggaacagccgcgcccccctccctgcggccgccgccccctg
cctctcggctctgctccctgccgcgtgcgcctgggccgtgcgccccggcaggccccagcc
ATGTCGATGCTGCCGTCGTTTGGCTTTACGCAGGAGCAAGTGGCGTGCGTGTGCGAGGTT
CTGCAGCAAGGCGGAAACCTGGAGCGCCTGGGCAGGTTCCTGTGGTCACTGCCCGCCTGC
GACCACCTGCACAAGAACGAGAGCGTACTCAAGGCCAAGGCGGTGGTCGCCTTCCACCGC
GGCAACTTCCGTGAGCTCTACAAGATCCTGGAGAGCCACCAGTTCTCGCCTCACAACCAC
CCCAAACTGCAGCAACTGTGGCTGAAGGCGCATTACGTGGAGGCCGAGAAGCTGCGCGGC
CGACCCCTGGGCGCCGTGGGCAAATATCGGGTGCGCCGAAAATTTCCACTGCCGCGCACC
ATCTGGGACGGCGAGGAGACCAGCTACTGCTTCAAGGAGAAGTCGAGGGGTGTCCTGCGG
GAGTGGTACGCGCACAATCCCTACCCATCGCCGCGTGAGAAGCGGGAGCTGGCCGAGGCC
ACCGGCCTCACCACCACCCAGGTCAGCAACTGGTTTAAGAACCGGAGGCAAAGAGACCGG
GCCGCGGAGGCCAAGGAAAG
gtacgcggcgtgcttcccgcgactcgggcgaccctaggaagccgtcctttctcctccgcc
ccctcccgcccccgcaggcaccagccaccaagtcctccccgccggccggagcccgtccac
ggggcggcgcgcaggccctccgcggcgctgcagcgaaagttcatgaactctgaggttcct

 1.02 Term +   2111   2219  109  2  1  121   49    59 0.762   3.58
agaagcgggagctggccgaggccaccggcctcaccaccacccaggtcagcaactggttta
agaaccggaggcaaagagaccgggccgcggaggccaaggaaaggtacgcggcgtgcttcc
cgcgactcgggcgaccctaggaagccgtcctttctcctccgccccctcccgcccccgcag
GCACCAGCCACCAAGTCCTCCCCGCCGGCCGGAGCCCGTCCACGGGGCGGCGCGCAGGCC
CTCCGCGGCGCTGCAGCGAAAGTTCATGAACTCTGAGGTTCCTTGCTAA
ggatggggcctcatttgctttgagcacccgcgcgtgggtttctctgggatgtgagtgtcg
ggaaatattggcgctagatttggtctttatgcctccctggctggccgcggctatgagtgg
tgggtggagagtgagtttctaaatcaacgggcagtgaaatgttgattggtgtcgcaagga

Predicted peptide sequence(s):


>SIX1_1|GENSCAN_predicted_peptide_1|222_aa
MSMLPSFGFTQEQVACVCEVLQQGGNLERLGRFLWSLPACDHLHKNESVLKAKAVVAFHR
GNFRELYKILESHQFSPHNHPKLQQLWLKAHYVEAEKLRGRPLGAVGKYRVRRKFPLPRT
IWDGEETSYCFKEKSRGVLREWYAHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDR
AAEAKERHQPPSPPRRPEPVHGAARRPSAALQRKFMNSEVPC