GENSCAN 1.0	Date run: 15-Jan-104	Time: 06:52:10

Sequence RIPK3_1 : 6051 bp : 55.89% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +   1128   1220   93  0  0   53  101    29 0.308   0.28
gaaaggcactagctttcgctctgccccctgccccaccccaggggcgggactgtagaggcg
cctataagggaagttgttcagtcaactcggaaaaagggtaacaacccggaaagtagactc
accgtcttggtctagagactgacccctgcacagacagaccccttcccctctctgcgaaag
GACCAAGCCCCAGAAGTCACTCCATCTCCTACGGCTCGCAATTTCCAGAGGCCCCCTGGC
ACCTTCCAGCCTGATGTCGTGCGTCAAGTTATG
gtgagtagggagtggcatgtcgatcgcagcctccgacattcacacccagagagccccaca
gactcgctcagagaacgtctttgagtccggggacggtgggggccggcgagggaggctggg
gattgcagtgagaacgccgagtcacaggggcgcggggagcagcgctgaggcacggcacgg

 1.02 Intr +   1430   1570  141  2  0   29   80   221 0.674  15.38
cctccgacattcacacccagagagccccacagactcgctcagagaacgtctttgagtccg
gggacggtgggggccggcgagggaggctggggattgcagtgagaacgccgagtcacaggg
gcgcggggagcagcgctgaggcacggcacggccggctagtgggcgacacccctctctcag
GCCCAGCGGTGCCCCCGCCCCCTTGGTGTCCATCGAGGAACTGGAGAACCAGGAGCTCGT
CGGCAAAGGCGGGTTCGGCACAGTGTTCCGGGCGCAACATAGGAAGTGGGGCTACGATGT
GGCGGTCAAGATCGTAAACTC
gtgagtgaccccggttgaccccagccgcaatctggccaaaaaggtggagccactgtgctc
tggggcctgaatggcgaagggagggattttcccacgaccccggtgcgactccagctctct
cctggagtgtaggaaggcgatatccagggaggtcaaggccatggcaagtctggataacga

 1.03 Intr +   1685   2012  328  2  1   23   82   464 0.564  35.55
cggcacagtgttccgggcgcaacataggaagtggggctacgatgtggcggtcaagatcgt
aaactcgtgagtgaccccggttgaccccagccgcaatctggccaaaaaggtggagccact
gtgctctggggcctgaatggcgaagggagggattttcccacgaccccggtgcgactccag
CTCTCTCCTGGAGTGTAGGAAGGCGATATCCAGGGAGGTCAAGGCCATGGCAAGTCTGGA
TAACGAATTCGTGCTGCGCCTAGAAGGGGTTATCGAGAAGGTGAACTGGGACCAAGATCC
CAAGCCGGCTCTGGTGACTAAATTCATGGAGAACGGCTCCTTGTCGGGGCTGCTGCAGTC
CCAGTGCCCTCGGCCCTGGCCGCTCCTTTGCCGCCTGCTGAAAGAAGTGGTGCTTGGGAT
GTTTTACCTGCACGACCAGAACCCGGTGCTCCTGCACCGGGACCTCAAGCCATCCAACGT
CCTGCTGGACCCAGAGCTGCACGTCAAG
gtcagctggtctacacccctctcagcctcaagacaaggccccagagctgctccagccagg
cccgccggacactagacctccagagccctgtctattgaataggcgtagcctctctctctg
gacacagggctgccaggggacaaagcccagccaggagttttagctcctgcctaccaggtg

 1.04 Intr +   2460   2605  146  2  2  135  110    73 0.996  13.79
cagaccttgacctagccctaccacaaggcacctagatctaccatccaagggaacctcttc
ccttgacctccacactccctttacaaagctgaacctgcaccttctgggggcaggggggtt
cctggaggctctctggcccccttgtcttccctacctcccacttctttccttcctttgcag
CTGGCAGATTTTGGCCTGTCCACATTTCAGGGAGGCTCACAGTCAGGGACAGGGTCCGGG
GAGCCAGGGGGCACCCTGGGCTACTTGGCCCCAGAACTGTTTGTTAACGTAAACCGGAAG
GCCTCCACAGCCAGTGACGTCTACAG
gtaaggatcccggcccaaacacacagccaggattcctacacttctctgggccctcccagg
ggatgatgtataggaaaggagtcttgccagtgattggaccgatcctcagctttgtgtctc
ctgcagcttcgggatcctaatgtgggcagtgcttgctggaagagaagttgagtgtaagac

 1.05 Intr +   2732   2778   47  2  2   84   47   -10 0.976  -6.96
agaactgtttgttaacgtaaaccggaaggcctccacagccagtgacgtctacaggtaagg
atcccggcccaaacacacagccaggattcctacacttctctgggccctcccaggggatga
tgtataggaaaggagtcttgccagtgattggaccgatcctcagctttgtgtctcctgcag
CTTCGGGATCCTAATGTGGGCAGTGCTTGCTGGAAGAGAAGTTGAGT
gtaagactctaggaggattctgggatccttaaccccaggtgcccttctcttgaaagcccc
aaggcttccccttcccgctcacctacttagactgccctcctccctcctcgtgcccccaca
ttacactccctgcctctttccatgatgaagcagataattcccttttaccctgaatgcctt

 1.06 Intr +   2987   3154  168  0  0  101   84    88 0.776  10.13
ttaaccccaggtgcccttctcttgaaagccccaaggcttccccttcccgctcacctactt
agactgccctcctccctcctcgtgcccccacattacactccctgcctctttccatgatga
agcagataattcccttttaccctgaatgccttctcttctcaccctcctcccctactccag
TGCCAACCGAACCATCACTCGTGTACGAAGCAGTGTGCAACAGGCAGAACCGGCCTTCAT
TGGCTGAGCTGCCCCAAGCCGGGCCTGAGACTCCCGGCTTAGAAGGACTGAAGGAGCTAA
TGCAGCTCTGCTGGAGCAGTGAGCCCAAGGACAGACCCTCCTTCCAGG
gtgagctggccagttagctggatctaggataagcttgggtctgtcagcagggggcttttc
tcaggaaaagaagatttgctcacctgcactccactctgctgtccctctagaatgcctacc
aaaaactgatgaagtcttccagatggtggagaacaatatgaatgctgctgtctccacggt

 1.07 Intr +   3265   3332   68  2  2   97  113    68 0.794   9.32
ttagaaggactgaaggagctaatgcagctctgctggagcagtgagcccaaggacagaccc
tccttccagggtgagctggccagttagctggatctaggataagcttgggtctgtcagcag
ggggcttttctcaggaaaagaagatttgctcacctgcactccactctgctgtccctctag
AATGCCTACCAAAAACTGATGAAGTCTTCCAGATGGTGGAGAACAATATGAATGCTGCTG
TCTCCACG
gtgagtgccaacatcacccctccccaggagctggtcagggatggcacagcgtggctacct
ggccatccaatgactcaccactgaccactgctttttatgccttgacctttgtacccaccg
tccccagcccacccctgagttcccagacaacagattatggaccgagagactactcccttg

 1.08 Intr +   3567   3941  375  2  0  101   94    87 0.566   6.37
ctacctggccatccaatgactcaccactgaccactgctttttatgccttgacctttgtac
ccaccgtccccagcccacccctgagttcccagacaacagattatggaccgagagactact
cccttgggtttactctggctcatccaagtcatacccagcaaactcctcccatccctgcag
GTAAAGGATTTCCTGTCTCAGCTCAGGAGCAGCAATAGGAGATTTTCTATCCCAGAGTCA
GGCCAAGGAGGGACAGAAATGGATGGCTTTAGGAGAACCATAGAAAACCAGCACTCTCGT
AATGATGTCATGGTTTCTGAGTGGCTAAACAAACTGAATCTAGAGGAGCCTCCCAGCTCT
GTTCCTAAAAAATGCCCGAGCCTTACCAAGAGGAGCAGGGCACAAGAGGAGCAGGTTCCA
CAAGCCTGGACAGCAGGCACATCTTCAGATTCGATGGCCCAACCTCCCCAGACTCCAGAG
ACCTCAACTTTCAGAAACCAGATGCCCAGCCCTACCTCAACTGGAACACCAAGTCCTGGA
CCCCGAGGGAATCAG
gtgagacattgacaggattaggggatgcactaagagtcctataaatgctgtccccttgcc
agcgaaaacttggggctgagaggagtgcagtgggagtgccaggctccagggcagaactgg
atgctctgtgctgtttgcagggggctgagagacaaggcatgaactggtcctgcaggaccc

Predicted peptide sequence(s):


>RIPK3_1|GENSCAN_predicted_peptide_1|456_aa
XTKPQKSLHLLRLAISRGPLAPSSLMSCVKLWPSGAPAPLVSIEELENQELVGKGGFGTV
FRAQHRKWGYDVAVKIVNSSLLECRKAISREVKAMASLDNEFVLRLEGVIEKVNWDQDPK
PALVTKFMENGSLSGLLQSQCPRPWPLLCRLLKEVVLGMFYLHDQNPVLLHRDLKPSNVL
LDPELHVKLADFGLSTFQGGSQSGTGSGEPGGTLGYLAPELFVNVNRKASTASDVYSFGI
LMWAVLAGREVELPTEPSLVYEAVCNRQNRPSLAELPQAGPETPGLEGLKELMQLCWSSE
PKDRPSFQECLPKTDEVFQMVENNMNAAVSTVKDFLSQLRSSNRRFSIPESGQGGTEMDG
FRRTIENQHSRNDVMVSEWLNKLNLEEPPSSVPKKCPSLTKRSRAQEEQVPQAWTAGTSS
DSMAQPPQTPETSTFRNQMPSPTSTGTPSPGPRGNQ