GENSCAN 1.0	Date run: 15-Jan-104	Time: 06:50:17

Sequence PSME2_1 : 5681 bp : 52.39% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1266   1313   48  2  0   95   95    47 0.991   7.12
tagtggcaactggctgggaatggctgaggggctacctactgcttgcggcctgccagcggg
aggaggggggcggaaagaagaaagggggcggggttgaggggggcgggcctggacctgggg
agtgaaagcgaaagcccgggcgactagccgggagaccagagatctagcgactgaagcagc
ATGGCCAAGCCGTGTGGGGTGCGCCTGAGCGGGGAAGCCCGCAAACAG
gtaatggggaatcggaggccaggaaggggtcatagaaccctcttgggtggaggccaagct
gggtggttcaggggaccaagcagtgccagagaactcccccaatctcgctagtgccttcac
ttctcggggattcccagattcctgccttctgactgcagtgagcaggagcttccagggaaa

 1.02 Intr +   2075   2137   63  1  0   78   89    15 0.487   0.01
cagtcctaaccttcgttctgccatttaccagcttgggcaagtcctttcattttcaggtct
tcagtttcctcatttgcaagtcttggacccagtgatttccaaaggcccttccagttccat
ttgtcagacatctcattgagcatattctgtgattcccctcccttgcaatgtaacccacag
GCTGAGGAATTCCTCTACAGATTCTTGCCACAGAAAATCATATACCTGAATCAGCTCTTG
CAA
gtgagtagtgtgggccccttctgccccatcctatgtcctctatcccctttgcccaccctc
tctagctaacaactggattcagcatgcagagaatagtttcaaatagtggattaggaacat
taggatggcgtgaggcatgagcctaggttgggaggcagagtgcaagtgggatgtatggag

 1.03 Intr +   2574   2604   31  2  1   90  116    35 0.991   4.69
aatgtggctgacttgacttccctccgggccccactggacatccccatcccagaccctcca
cccaaggatgatgaggtgaggcactcagggtgcaggacttggactataaacccaatggag
aagatagcccttcaacctctgtgacttttctaaagctactttcccccctttttgccttag
ATGGAAACAGATAAGCAGGAGAAGAAAGAAG
gtaagagagataagaggtgactagggaaggggtgatggcacactgactactggatgagaa
agggcctgaatcccctctttctcacagtccataagtgtggatttctccctgggaatgaga
aagtcctgtccctgcttgccctggttaagccagaagtctggactctcaaagagaaatgca

 1.04 Intr +   2692   2789   98  2  2   53  107    43 0.994   2.93
agaagatagcccttcaacctctgtgacttttctaaagctactttcccccctttttgcctt
agatggaaacagataagcaggagaagaaagaaggtaagagagataagaggtgactaggga
aggggtgatggcacactgactactggatgagaaagggcctgaatcccctctttctcacag
TCCATAAGTGTGGATTTCTCCCTGGGAATGAGAAAGTCCTGTCCCTGCTTGCCCTGGTTA
AGCCAGAAGTCTGGACTCTCAAAGAGAAATGCATTCTG
gtaagcctgggaaatgggggaagcagaaagagaagacacacaaggtgaggccctggactc
ctccgtagatacaagtccttcatacagagacctagtcctgaaaaagaaaacttccttctg
tgccttgggcttagatcccctttgttctcctcgttctgttagacctctcttatcacaacg

 1.05 Intr +   3379   3447   69  0  0   76  110    52 0.984   6.07
gggtacaataaatacatatctctgaaggttgctgtgatgattacatgaaataaatacatg
gcacagtacctggtatgtaataagtacccaattaaatataactttttttaggaagtgaca
gtaataggaagaactcagtatgtttgttgaatgattcttacatgatacctcttaacacag
GTGATTACATGGATCCAACACCTGATCCCCAAGATTGAAGATGGAAATGATTTTGGGGTA
GCAATCCAG
gtaagaaaagggtaactgaagatacttagagtggggagagcctcagggggtgagctagac
atgaaccaggaggaggaggaagatagtgtatgaaatggggaggacatgaagtgttgtctt
tgcctcccgtgtcaccacaggagaaggtgctggagagggtgaatgccgtcaagaccaaag

 1.06 Intr +   3588   3655   68  2  2   71   61    90 0.995   2.80
caagattgaagatggaaatgattttggggtagcaatccaggtaagaaaagggtaactgaa
gatacttagagtggggagagcctcagggggtgagctagacatgaaccaggaggaggagga
agatagtgtatgaaatggggaggacatgaagtgttgtctttgcctcccgtgtcaccacag
GAGAAGGTGCTGGAGAGGGTGAATGCCGTCAAGACCAAAGTGGAAGCTTTCCAGACAACC
ATTTCCAA
gtgagggcagctggaggaccagcattgggggcagtaggagcatttctttgggacccccag
agctgggcagccctatcaggatgatgggagactttgggaagggtctgagggagtacatct
ccctgaacactcattcctgtggtattcccttgcttctggcaggtacttctcagaacgtgg

 1.07 Intr +   3818   3872   55  2  1   89   67    76 0.995   5.07
ccagacaaccatttccaagtgagggcagctggaggaccagcattgggggcagtaggagca
tttctttgggacccccagagctgggcagccctatcaggatgatgggagactttgggaagg
gtctgagggagtacatctccctgaacactcattcctgtggtattcccttgcttctggcag
GTACTTCTCAGAACGTGGGGATGCTGTGGCCAAGGCCTCCAAGGAGACTCATGTA
gtgagtggatagtccaccagccttttagctgggtgtgggacgaggaggtgtggaggaaga
agtcctccttgtcttgtttgtgactttcccaatgtggagaatattaagctaaaagcatta
cctagaaaaactggtttgggcttcaacaaccttgacccttttctctgctcagtcctttgg

 1.08 Intr +   4176   4262   87  2  0  100   73    90 0.981   9.36
agaaaaactggtttgggcttcaacaaccttgacccttttctctgctcagtcctttgggat
cctatttcttggtgctaagaaggggttcattctcaagttaacctatttcctataaaagga
aaccagactcatgtcccagcctcccatgggactgactcagctttgcctcccacattgcag
ATGGATTACCGGGCCTTGGTGCATGAGCGAGATGAGGCAGCCTATGGGGAGCTCAGGGCC
ATGGTGCTGGACCTGAGGGCCTTCTAT
gtgagtgtggagtaaggctttaggggaggtggatgagtgggggcaggcaggggattggct
aagaacctgactcttgcactctggccttctcccaggctgagctttatcatatcatcagca
gcaacctggagaaaattgtcaacccaaagggtgaagaaaagccatctatgtactgaaccc

 1.09 Term +   4358   4438   81  1  0   85   46   105 0.978   3.99
ggattaccgggccttggtgcatgagcgagatgaggcagcctatggggagctcagggccat
ggtgctggacctgagggccttctatgtgagtgtggagtaaggctttaggggaggtggatg
agtgggggcaggcaggggattggctaagaacctgactcttgcactctggccttctcccag
GCTGAGCTTTATCATATCATCAGCAGCAACCTGGAGAAAATTGTCAACCCAAAGGGTGAA
GAAAAGCCATCTATGTACTGA
acccgggactagaaggaaaataaatgatctatatgttgtgtggattcccttctggcgtgt
gtcattcattcaaaaagcatttattgagtggcacctatgtccagcctgaagatgaatgtg
gtgggaaggggtgggtgtcacaaagacaaagatgacttagatgcccactgtaatcttgac

Predicted peptide sequence(s):


>PSME2_1|GENSCAN_predicted_peptide_1|199_aa
MAKPCGVRLSGEARKQAEEFLYRFLPQKIIYLNQLLQMETDKQEKKEVHKCGFLPGNEKV
LSLLALVKPEVWTLKEKCILVITWIQHLIPKIEDGNDFGVAIQEKVLERVNAVKTKVEAF
QTTISKYFSERGDAVAKASKETHVMDYRALVHERDEAAYGELRAMVLDLRAFYAELYHII
SSNLEKIVNPKGEEKPSMY