GENSCAN 1.0	Date run: 15-Jan-104	Time: 06:47:10

Sequence PSMB5_1 : 11449 bp : 47.52% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1220   1417  198  1  0   94   70    71 0.383   4.88
cccttcagtgaaaatggtctttcgcatctggcccttctttttggaggcgtgcttgccagc
agtcaaaatggctccattccggaatagatttaataggaagtgaagctgtgacggcgaggc
gttgcccggcctatctttgctaggcgttctcagaattagttctttctgcccacactagac
ATGGCGCTTGCCAGCGTGTTGGAGAGACCGCTACCGGTGAACCAGCGCGGGTTTTTCGGA
CTTGGGGGTCGTGCAGATCTGCTGGATCTAGGTCCAGGGAGTCTCAGTGATGGTCTGAGC
CTGGCCGCGCCAGGCTGGGGTGTCCCAGAAGAGCCAGGAATCGAAATGCTTCATGGAACA
ACCACCCTGGCCTTCAAG
gtgtggagccagcccccttgccaggctgagtactgaacgcccgcgacttgcctggcctcc
cagcctgaccggagtttgcggtggccttggccaccaacccaggcggaggctgggtcctct
cgttcggaccgcagcagttttgctgtctcattggcccaggaggcccctgtctttgctctg

 1.02 Intr +   2427   2733  307  2  1   69  105   291 0.949  24.92
caagggattgatgtgaagctcgggtgacattaatatatggtgaagtatagaagtatactg
tgaagtataaaaggacggagaaagagatgtgctgggtttggattgatgcaaaaagaagta
tgtaggagtgtttttgtggtcttatgtggcctgttttgtgttttcctctgatcttaacag
TTCCGCCATGGAGTCATAGTTGCAGCTGACTCCAGGGCTACAGCGGGTGCTTACATTGCC
TCCCAGACGGTGAAGAAGGTGATAGAGATCAACCCATACCTGCTAGGCACCATGGCTGGG
GGCGCAGCGGATTGCAGCTTCTGGGAACGGCTGTTGGCTCGGCAATGTCGAATCTATGAG
CTTCGAAATAAGGAACGCATCTCTGTAGCAGCTGCCTCCAAACTGCTTGCCAACATGGTG
TATCAGTACAAAGGCATGGGGCTGTCCATGGGCACCATGATCTGTGGCTGGGATAAGAGA
GGCCCTG
gtgagttaagctgcaaccacatgatccttgggctgacactacagtgaggaggggttggat
ggacagatgaattaaagggcttggtgtcaatgctgaagaagtgtaattaggtccttagcc
cttccttctctctttttttttttcctgtttttttagactgtgtctcattctgtcgctcag

 1.03 Term +   9726  10012  287  1  2  100   48   446 0.978  37.37
atcactttaacccaggaggcggaggttgtggtgagccgagattgcgccattgcactctag
cttgggcaacaagagcaaaactccatctcaaaaaaaaagaactactgccttggcatatga
attagatatcaaaaggggtgatctttttttttttcctgctaacctcatctccctttccag
GCCTCTACTACGTGGACAGTGAAGGGAACCGGATTTCAGGGGCCACCTTCTCTGTAGGTT
CTGGCTCTGTGTATGCATATGGGGTCATGGATCGGGGCTATTCCTATGACCTGGAAGTGG
AGCAGGCCTATGATCTGGCCCGTCGAGCCATCTACCAAGCCACCTACAGAGATGCCTACT
CAGGAGGTGCAGTCAACCTCTACCACGTGCGGGAGGATGGCTGGATCCGAGTCTCCAGTG
ACAATGTGGCTGATCTACATGAGAAGTATAGTGGCTCTACCCCCTGA
aagagggtggatgcagctgcttgtgtttcttggggtgactgtcattggtaatacggacac
agtgacccatcctccatcctatttatagtggaagggccttcaattgtatcagtacttttt
tttaagctctggcacattgacctctatgtgttaccagtcattaatgagctgctgcagagg

Predicted peptide sequence(s):


>PSMB5_1|GENSCAN_predicted_peptide_1|263_aa
MALASVLERPLPVNQRGFFGLGGRADLLDLGPGSLSDGLSLAAPGWGVPEEPGIEMLHGT
TTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLAR
QCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRI
SGATFSVGSGSVYAYGVMDRGYSYDLEVEQAYDLARRAIYQATYRDAYSGGAVNLYHVRE
DGWIRVSSDNVADLHEKYSGSTP