GENSCAN 1.0	Date run: 15-Jan-104	Time: 07:24:31

Sequence PSMA3_1 : 29533 bp : 40.19% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +    930   1130  201  2  0    4   25   168 0.373   0.66
ggtgaagtggatgccatcaagattctgggtcagggtcgggacgcggaggaagacaggtta
cttcgcgcctactgctttttctactttttgtgagagtataccagcatctctccctttggc
ttaaagaaagaataaagtgaggagagaataataatataaaagataaataataattccaag
GAAAGGAATAGAGCAGCTTCTCAGATACCACGACGCCAAGCGGCTCAAAGTACGCGAACC
GAAGGAGGAGCCTTTGCTTTCCCCAACCCCGCCTCCATTGCTTCTGCACATGCGCGCCGC
CAGCCTCTCGCGGCCCGCTTTTTTCCCACAATACTCCTCGTCCTGGGGGCCGGAGCCGCG
GAACGAGCCACAGAGAAAAAG
gttattggttggcagttcagccaatgagcgggcctgttactagtttgcggcatcctgtgg
tataggggaagcgctccgggcctggaatccctacgcgtccctttgggtttagcacgatga
gctcaatcggcactggggtgagttcgctgtctgtcggtgtaatagtttaacctaaggatt

 1.02 Intr +   1196   1267   72  1  0   41   84   117 0.605   5.28
ccccgcctccattgcttctgcacatgcgcgccgccagcctctcgcggcccgcttttttcc
cacaatactcctcgtcctgggggccggagccgcggaacgagccacagagaaaaaggttat
tggttggcagttcagccaatgagcgggcctgttactagtttgcggcatcctgtggtatag
GGGAAGCGCTCCGGGCCTGGAATCCCTACGCGTCCCTTTGGGTTTAGCACGATGAGCTCA
ATCGGCACTGGG
gtgagttcgctgtctgtcggtgtaatagtttaacctaaggattggggttgaagggaactc
ggacagaccacatggggttcgcggacccggggtgctctgagaccgccttcggctgggtgg
gccatttgcagctgtttggagaccggtcgtctttatcccctatatgctaggcctgcgtct

 1.03 Intr +   4076   4158   83  1  2   55   82    34 0.341  -2.98
ggtatatagctttatcttagctactgttgctgctctgacaagtttccctttcctctcttg
aaagcaaggtctttgttgggatataacaggttcctgatgtttcagccatttagaggggaa
gaaactgtatggtcattactgccaaagatacaagcttactgttgcccttttctccttaag
TATGACCTGTCAGCCTCTACATTCTCTCCTGACGGAAGAGTTTTTCAAGTTGAATATGCT
ATGAAGGCTGTGGAAAATAGTAG
gtaagaaacatttaaccaggtattacatgtctccttttattttatatatttttggcgatt
aggctttgttatgttactttggtacaaattagtatatgtccccaaatctcaatttattca
tttccagatctctttctaggccagatgctttccatgagccccagtcctatatttctcgtt

 1.04 Intr +   8445   8568  124  0  1  103   91   116 0.932  13.07
tatttatatggatttaatgtatttattacactttagtgtgttttctcttcctggttttca
aatgttttaaggtatttggcatgccttaaatgttacttattttgtttttttgttaaactt
aagtttatgaagtttcttttattttcagttaaaaaactgattttcttctccttgtttcag
TACAGCTATTGGAATCAGATGCAAAGATGGTGTTGTCTTTGGGGTAGAAAAATTAGTCCT
TTCTAAACTTTATGAAGAAGGTTCCAACAAAAGACTTTTTAATGTTGATCGGCATGTTGG
AATG
gtaaggtcatgtttaaaatgttcctttttgtcttgtccaatttcttttgaagtaactgat
tggaatagatcactgtgcagtcacaaaagtaatcagagcaagttactgcatttgtccagt
tcactgtccagtagaaaggcagcattctcataaccttattagtgatgggggaaaaaccaa

 1.05 Intr +  14071  14172  102  0  0   74  106   124 0.999  12.25
ttctaaattataatttcatactcaagcatcaaaatgccttgtagagagacctttaagcca
aaaaagtttattttgaatggtaatacttgttaaaaaaatgtttaataagtctttattaat
tgcagactttgatttgtgataggaatgtgttcctctagtaaattggtgcttttttttcag
GCAGTAGCAGGTTTGTTGGCAGATGCTCGTTCTTTAGCAGACATAGCAAGAGAAGAAGCT
TCCAACTTCAGATCTAACTTTGGCTACAACATTCCACTAAAA
gtaagttgataacatattgaggaaccttttggacagtaatagaagtttattaataagctc
ttctgcttccctccatagcatcttgcagacagagtggccatgtatgtgcatgcatataca
ctctacagtgctgttagaccttttggctgcaggtaagaaattttgtgaattattcaaaag

 1.06 Intr +  14251  14324   74  0  2   97  110    69 0.996   7.29
gcagtagcaggtttgttggcagatgctcgttctttagcagacatagcaagagaagaagct
tccaacttcagatctaactttggctacaacattccactaaaagtaagttgataacatatt
gaggaaccttttggacagtaatagaagtttattaataagctcttctgcttccctccatag
CATCTTGCAGACAGAGTGGCCATGTATGTGCATGCATATACACTCTACAGTGCTGTTAGA
CCTTTTGGCTGCAG
gtaagaaattttgtgaattattcaaaaggcagatctgtactatagatatttattatgttc
cccagcatcttagccttttacatacttaaaaatagaaactcgtcgataagtattagggca
atgattaaataaaacagtgtacatagaaactacttgaggctgggtgccatggctcaagcc

 1.07 Intr +  17274  17346   73  0  1   55   83    78 0.962   2.49
tgaataatctcatgtaatagttttaattaattgaaaccactgtttcaaagtacttactga
gttatatgtgtattagtaatttatctcagaaagaaaatataactgcattttaaaataatt
ttttcacaaatacttttatgttattgccatggtttaagctgtttgtatactttcatgcag
TTTCATGTTAGGGTCTTACAGTGTGAATGACGGTGCGCAACTCTACATGATTGACCCATC
AGGTGTTTCATAC
gtgagtaattttgaatcatttgaaattctattttagtttaatggtatttcattagcattt
aagtctcattataagattatatgaaattaaaaaaaaactcattcaaggaaagtaattttt
cttttttttttttttacaacaacctcttgtccaacagaatttttttttttttcctttttg

 1.08 Intr +  20031  20096   66  2  0   84   90   100 0.979   7.98
tggtattttagtatttttgagccctttggcattcatcagaatgtgtttgactatattttt
ctatacttgcttttaaaagtcatttagcatcctttcactaggttatagaaacattagtag
tcattaattacatatgatagtgtactaattcagtgattatatatatttttttctaaatag
GGTTATTGGGGCTGTGCCATCGGCAAAGCCAGGCAAGCTGCAAAGACGGAAATAGAGAAG
CTTCAG
gtaataattaatgcttgaatttttactatgtcgtcatcctaatgcagtgaaattttatca
ccacagacatttcagtctaaggcagggatgtccaatcatttggcttccctgggccacaca
taaaatacaccaacactaatgatagctgatgagcttaaaaaaaaatctcatcatgtgtta

 1.09 Intr +  23800  23846   47  0  2   64  101    82 0.903   3.39
acccagcctggagtataaatttcaaaacattaaaatatgaatcaggaaacttcgattctg
gtctttttcagactttaggttattttccttggttttatatctgagtataaaagtgaaaat
agttattacacaagtggaaaatgttcttctgatgaacagtatacattttattttctatag
ATGAAAGAAATGACCTGCCGTGATATCGTTAAAGAAGTTGCAAAAAT
gtaagttgaaatttttcttaccatccacaaaaatatttcatttgacctttgcatatatat
attacattaatcctaagaagctgttttcctgtaaaataacttagtgtataatttttagaa
ggtaaatttaacattctaagaagcctcacgaaggaagaaaatgtttttaagcaatatttt

 1.10 Intr +  26744  26811   68  2  2   83  101    58 0.998   4.23
tatttcagtccctgtgtaatttgtcttctctaatgttaaatactatgtagaatgtgtctg
tgtaattttatagatacttttattatggatggacattctaatttgtactgactttgggtc
tgtgaactacttcaatgtttggaggttaccaaaatcttacctttcccttttctattctag
AATTTACATAGTACATGACGAAGTTAAGGATAAAGCTTTTGAACTAGAACTCAGCTGGGT
TGGTGAAT
gtaagttatttttgtacatttatttgccttaggaatgatctgtaccacagctaatttaca
actgagtgtcctttctaatataatgaaagctaaagcaaatttactaggttgtctaatgaa
gggaaagttctgcttaataattgacttaagttgtgaacacgttattttttgaaacatcca

 1.11 Intr +  27260  27324   65  0  2   41  121    88 0.964   4.92
tgtaggcacatataatctcatgtagaagcagcacacaaaaatattcgagtattactcata
gtacaactttgcaaccttaggtgagtcagatatgtggattgggtagatcctatggtatac
tgcaagttacaatatggtactcaatttaaaattcatttacacatgtggcttaatttacag
TAACTAATGGAAGACATGAAATTGTTCCAAAAGATATAAGAGAAGAAGCAGAGAAATATG
CTAAG
gtaagccacagcacaaaaacttctcttggccaggtacagtcagggaatcacttagcccag
gagtttgagaccagcctgagcagcacagcaagacccccatccctaatttaaaaaaaaaaa
aattctctaaccaaaattatgtgttgaataatataaatagactggggtggtttctatgaa

 1.12 Term +  28177  28221   45  0  0  111   38    87 0.993   2.23
atgttagagcaacatttgcttaattaactttgcttgggtatcttattctgaaactgttca
ttcagttacaagtagaggaatttaaccacttaattcaggttgttgtagcttaacttgccc
acaggtgtgggatataacaattttaaaaatcaattttaaacacctgttttctcttaacag
GAATCTCTGAAGGAAGAAGATGAATCAGATGATGATAATATGTAA
catttactccagcatctattgtattttaaatttctactccagtccaatgtaactatttag
ccctggattatacatactgtccaattttcattaaatttttgtcttataactattgaagtt
tggttaatatctgctttacaaaattggtgggggtaaatgaggacatttactcagtattaa

Predicted peptide sequence(s):


>PSMA3_1|GENSCAN_predicted_peptide_1|339_aa
ERNRAASQIPRRQAAQSTRTEGGAFAFPNPASIASAHARRQPLAARFFPTILLVLGAGAA
ERATEKKGKRSGPGIPTRPFGFSTMSSIGTGYDLSASTFSPDGRVFQVEYAMKAVENSST
AIGIRCKDGVVFGVEKLVLSKLYEEGSNKRLFNVDRHVGMAVAGLLADARSLADIAREEA
SNFRSNFGYNIPLKHLADRVAMYVHAYTLYSAVRPFGCSFMLGSYSVNDGAQLYMIDPSG
VSYGYWGCAIGKARQAAKTEIEKLQMKEMTCRDIVKEVAKIIYIVHDEVKDKAFELELSW
VGELTNGRHEIVPKDIREEAEKYAKESLKEEDESDDDNM