GENSCAN 1.0	Date run: 15-Jan-104	Time: 07:28:11

Sequence PPM1A_1 : 50000 bp : 36.68% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   3897   4471  575  2  2   47   82   362 0.723  24.13
gcagctgttatgtttctgattattctcctgattttgaaaaatcctgttcccttaacctac
ctcattggaggtcgttggaggtcccctgggacagaaccacgtgattatctaacatgtgca
aataaatacaatgtggaatcccctgaactatagagggaaaacctgccagaaactcagagc
ATGTGCCCCGTGCGTGAATCAGTTGCACTCGCACATTGGTGGGCGGTGGTAGCGTGCTTG
TGTCTCTGCCCTTTGGGTCGCGAGGTGTGTGGCCGTGGCACCTGCTTGGGCTTCCTGGGG
TCACTGGGAGAGGAAGGCTCTGGAGGAGTGGGACTCTGGGGTAGGGGGGTCTGGCAGCTG
CCTGGGACCCACCATGGGTTCGAAGGGCAGCGGCCAGACCGCGACGGCGCCCAAGAAGGG
TGGACAGCTTCGGGTCTGTGCTCGGGGCTGCGTGTACACCATCTTCGCAGGGAGTGGGGT
TTGTATCTGCAGGCAGGTAGAAGAGCCAGGGCTCCGGGCGCGGACGCCGTAGGGGTAGCT
TCCGAGTCCCTACTTGGCCAAGGGCCGGCACGGAGGGGCTGTCGATCTACTGGGCACCTA
ATAGCCGCACATTCTGTCCAGTCCCTGGCGCCGGAACGTGAAGGCCCGGGTCCTGGCTGC
TATCCGGGATCCGGACGCTCCCTTCGGCTTCGGCCTGGTGCTCCAGGCCGTAAGGCAAAG
GCGGCGGCAGCAGCAGCGGCAGAGAAAGAAGCTGG
gtaaggcagtgacgtcatctgtggcggcccctcccccgcccgccagccctcaccgcagtt
cctgcccaacgacatccgggtctctgtagctgcgcgccgcgccgcagctgtagcggcggc
ggagccagcggggcggggcgagcggaggggtgggggaggggcgacgcggtcgtgagcgcg

 1.02 Intr +   4994   5126  133  2  1  104  114    92 0.952  13.13
gtggggggactctagacagctgaggcgcgaaagcgatgagtcctcggctcttcctcctcc
ttctccgggacccgctctctgcctccctctccaacgcccggatgatctgagccgcgaggg
cgccgacagccgggggcccggacgcagcccggctcctcccctcctccgccccttccccag
CCTGACCTGGCCCGCCGCTGCAGCGGTGACCCCTCCCCCGGCTGCCGCCGTCGCCGCCGC
GGTGACCCCCTCCCCGGCTGCCGCCGCCGCCGCCTCGGCCGACCAGGGACCTGCCCGCCT
GCGGCTGCTCCGG
gtaagtgcggcgctcgggccgacggcgggctggcgggcggtgcgggcctgcgcggcggcg
gcggcgggcaggcctggggcctgtaaacaagccgggcgtctgcccgggcgctcccgggag
gagacgcgacaactccaccccctggccggcctcctcccccgagccgggcggcggacggcg

 1.03 Intr +  12187  12315  129  0  0   56  106    28 0.228   1.37
ttgatactttgtgttcctcttatgttttcctagccttgacgttagcaactaacaatgata
actaacattattgagctcttatgtgccagggactattacaatagattttcaattattatc
tcattaaatcttcatagcagccctatgagctagatactgttactacctatatcttaacag
ATGAGGAAATTTGAAACAGAGCAGTTATTTGCCAAGAGTTTCAGAGCTATTAACAGAAGC
CTAATACATGTTCTTGGACTTTGCAGAAATAATTTGTTGATCCATGCGGTTTCATTGCTA
CTGCGGAAA
gtaagtctcttggccattgtgatgggtcaaaatctttgtacatgaagggtatgactgttg
ttccattgtatccagagagtgaatcttgtgattgagttgggatttgaggtggcagtgtat
actaagtttgaaaagtatattatcatatgttagctccctttagaaattttccccaagaag

 1.04 Intr +  32762  32814   53  1  2   37   94    58 0.001  -1.91
catggacaaattgaatccccttgggatttactatttatggatatacgccaatttaattat
tggactaaataaaatactctttattagtccacttatggaagatgactgtgtaaacatagt
atttgcaagtaagtactttttggtattatatttatataatcagctcttgtatccatgtag
CTTATAGTTGGCTGCTTCACCAGGACTCTACAAATTGCTCAGAACCCAAGGAG
gtaagatttttatattgcctgttttcagtatgtaaaagtccagccacaaaactattaatt
tacccttgactatatttttacagttgctgtggagctgaacctaaaattttgttagatggt
tacttggtttgttacatttttatatactaatttatatactataataatatactgtatata

 1.05 Intr +  37551  37624   74  0  2   42   68    87 0.003   0.23
tatgtatacagtacacttcgttatgtatatatataattgcttgcaacttgaaatttgagg
ctacaacatttacagtaatttaataacttaactgactttatcaaaaactgaaaaacctca
tggaaaaggtagaatgtaaggtagacttaaaaggataggtatacttttttctataaatag
GATGAGGCAAGAGTTTCCAGTTAAGGAAACTGACATGAGCAAAGGCTTGAAGGAGCATGC
AAATTTGGAGCATT
gtgagtagattattttttagtttttcagagttcatgcagtgggaataaaactagggagtt
tggaatcaagcttgaaaattcctgaatgttcaaccaagatatatttgagttagtagattt
tttgggtatgtcatgaattcgtttggcttttcttaattgatatacatacaacttagtcct

 1.06 Intr +  38133  38986  854  1  2  147   65   839 0.988  77.65
tcaggctttcccccagttcctccttgttaatctccagattccaagtcagcaacacaatga
atgtctgcttatcgcgagttgtgaattcccgcatatctctttcacttattaaaaagattg
tttggtacatattttgtttataagacagttattgactttcctgtttctcttcctttgcag
ACCTAGAGGATCAAGACATAATGGGAGCATTTTTAGACAAGCCAAAGATGGAAAAGCATA
ATGCCCAGGGGCAGGGTAATGGGTTGCGATATGGGCTAAGCAGCATGCAAGGCTGGCGTG
TTGAAATGGAGGATGCACATACGGCTGTGATCGGTTTGCCAAGTGGACTTGAATCGTGGT
CATTCTTTGCTGTGTATGATGGGCATGCTGGTTCTCAGGTTGCCAAATACTGCTGTGAGC
ATTTGTTAGATCACATCACCAATAACCAGGATTTTAAAGGGTCTGCAGGAGCACCTTCTG
TGGAAAATGTAAAGAATGGAATCAGAACAGGTTTTCTGGAGATTGATGAACACATGAGAG
TTATGTCAGAGAAGAAACATGGTGCAGATAGAAGTGGGTCAACAGCTGTAGGTGTCTTAA
TTTCTCCCCAACATACTTATTTCATTAACTGTGGAGACTCAAGAGGTTTACTTTGTAGGA
ACAGGAAAGTTCATTTCTTCACACAAGATCACAAACCAAGTAATCCGCTGGAGAAAGAAC
GAATTCAGAATGCAGGTGGCTCTGTAATGATTCAGCGTGTGAATGGCTCTCTGGCTGTAT
CGAGGGCCCTTGGGGATTTTGATTACAAATGTGTCCATGGAAAAGGTCCTACTGAGCAGC
TTGTCTCACCAGAGCCTGAAGTCCATGATATTGAAAGATCTGAAGAAGATGATCAGTTCA
TTATCCTTGCATGTGATGGTATCTGGGATGTTATGGGAAATGAAGAGCTCTGTGATTTTG
TAAGATCCAGACTTGAAGTCACTGATGACCTTGAGAAAGTTTGCAATGAAGTAGTCGACA
CCTGTTTGTATAAG
gtagctagactttttttaaaaacataaaatgattttatgccatattaatcactactctag
tatttaatcatcttagaatctgtaattctgaaaccagtttttggcacaactgtaggatac
tgttcaccaattatgaaaatatatcataggaccactatgtagaaataaattacccaatta

 1.07 Intr +  41073  41190  118  2  1   93   40    95 0.104   4.32
gggagggggagtcattgcacacacacacgcacgcatgcgtgcacatatgtatttttttct
ccctgaaagtaacattttcactagaacaagtataactgtaattggcacagctgtaaaggt
tctcaaggctttgaagagcaaaaagaaaactaaaatattctcaaatttttttcttcccag
GGAAGTCGAGACAACATGAGTGTGATTTTGATCTGTTTTCCAAATGCACCCAAAGTATCG
CCAGAAGCAGTGAAGAAGGAGGCAGAGTTGGACAAGTACCTGGAATGCAGAGTAGAAG
gtggatcatttaacaaaaaataagtagctttattaaagaaaaatcttcaacacaatcaaa
ctttaacattttagcttttagatttttatgtgtctttgacagctagtgtctagtgtatga
aagtggaaaaggacatttctgtagtagctgttaagatgtatgcagttgtcctatcacagt

 1.08 Intr +  45255  45363  109  1  1   17  108    83 0.057   1.62
cattttttgtcataaatcttcaaaggtcaacctgattttttttttttttaaatgatacca
gattagaaaaatctcagatgtggtaaatgccatctttaaaaagctaggttatctttgttt
cggttttcttttcaattaaatttggataacacttacaaaaaaagtacttctgattcccag
AAATCATAAAGAAGCAGGGGGAAGGCGTCCCCGACTTAGTCCATGTGATGCGCACATTAG
CGAGTGAGAACATCCCCAGCCTCCCACCAGGGGGTGAATTGGCAAGCAA
gtaagttacattctgtacactcttatgctttatgtcagtgtatgaaaatgttaggtattc
attgataaaatgtttgtttgcctaatttctgaactgatgcagttatctgtgttttaacct
gtgatttcaatttttttttagtattagaatatctagagtttgtttagacataggtatcag

 1.09 Intr +  47902  48043  142  1  1   66   72    72 0.037   2.83
gaacagattaaacattgctatttcatatgtacacatatatacttatatactttaaaaaac
atttatattctaaaagtcatctttacagaacattatctttctccattatccagaaagtat
ggtgtattttggcaccgctaaattttaacgttgttccttattttgcttccttttacaaag
GACTCTACATCAACAGATGATATGTGGTAAAACTGCTCATCTAGCCATGGAGTTTACCTT
CACCTCCAAAGGAGAGTACAGCTCAACTTTGTTGAAACTTTTAACATCCATCCTCAACTT
TAAGGAAGGGGATATGACATGG
gtgagaatgattacatcagagaacttcagcagtacaacagctagcccagaactgattttt
ttttttttttttgtaaatttgagacttatgtaagcgtgatttcaaaccataattcgtgtt
gtaaatcagactccagcaatttttgttgtatgattttgtttttttgtaaagtgtaattgt

Predicted peptide sequence(s):


>PPM1A_1|GENSCAN_predicted_peptide_1|729_aa
MCPVRESVALAHWWAVVACLCLCPLGREVCGRGTCLGFLGSLGEEGSGGVGLWGRGVWQL
PGTHHGFEGQRPDRDGAQEGWTASGLCSGLRVHHLRREWGLYLQAGRRARAPGADAVGVA
SESLLGQGPARRGCRSTGHLIAAHSVQSLAPEREGPGPGCYPGSGRSLRLRPGAPGRKAK
AAAAAAAEKEAGLTWPAAAAVTPPPAAAVAAAVTPSPAAAAAASADQGPARLRLLRMRKF
ETEQLFAKSFRAINRSLIHVLGLCRNNLLIHAVSLLLRKLIVGCFTRTLQIAQNPRRMRQ
EFPVKETDMSKGLKEHANLEHYLEDQDIMGAFLDKPKMEKHNAQGQGNGLRYGLSSMQGW
RVEMEDAHTAVIGLPSGLESWSFFAVYDGHAGSQVAKYCCEHLLDHITNNQDFKGSAGAP
SVENVKNGIRTGFLEIDEHMRVMSEKKHGADRSGSTAVGVLISPQHTYFINCGDSRGLLC
RNRKVHFFTQDHKPSNPLEKERIQNAGGSVMIQRVNGSLAVSRALGDFDYKCVHGKGPTE
QLVSPEPEVHDIERSEEDDQFIILACDGIWDVMGNEELCDFVRSRLEVTDDLEKVCNEVV
DTCLYKGSRDNMSVILICFPNAPKVSPEAVKKEAELDKYLECRVEEIIKKQGEGVPDLVH
VMRTLASENIPSLPPGGELASKTLHQQMICGKTAHLAMEFTFTSKGEYSSTLLKLLTSIL
NFKEGDMTW