GENSCAN 1.0	Date run: 15-Jan-104	Time: 07:02:42

Sequence NFKBIA_1 : 5627 bp : 53.67% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +   1067   1521  455  1  2   87   99   613 0.567  54.94
gggacaggattacagggtgcaggctgcagggaagtaccggggggagggggcctggtcgga
aggactttccagccactcggcgctcatcaaaaagttccctgtccgtgaccctagtggctc
atcgcagggagtttctccgatgaaccccagctcagggtttaggcttctttttccccctag
CAGAGGACGAAGCCAGTTCTCTTTTTCTGGTCTGACTGGCTTGGAAATTCCCCGAGCCTG
ACCCCGCCCCAGAGAAATCCCCAGCCAGCGTTTATAGGGCGCCGCGGCGGCGCTGCAGAG
CCCACAGCAGTCCGTGCCGCCGTCCCGCCCGCCAGCGCCCCAGCGAGGAAGCAGCGCGCA
GCCCGCGGCCCAGCGCACCCGCAGCAGCGCCCGCAGCTCGTCCGCGCCATGTTCCAGGCG
GCCGAGCGCCCCCAGGAGTGGGCCATGGAGGGCCCCCGCGACGGGCTGAAGAAGGAGCGG
CTACTGGACGACCGCCACGACAGCGGCCTGGACTCCATGAAAGACGAGGAGTACGAGCAG
ATGGTCAAGGAGCTGCAGGAGATCCGCCTCGAGCCGCAGGAGGTGCCGCGCGGCTCGGAG
CCCTGGAAGCAGCAGCTCACCGAGGACGGGGACTC
gtaagtggcggaggcccggggctgggggtcgtcgggagggcgggacgcgcgcggcctggg
ggtgggaggcgccgggcctggagcccgagccgggggaccagcgatgcagccgggcgggcg
ccgcggcaccccggggctcctgcaccgccccgaacgctgcagggctgcagggccgcgcgg

 1.02 Intr +   2141   2249  109  2  1  132   85   216 0.999  26.49
gggggcggaaagtccctgggcgcctgccaggaacactcagctcataataacctcgcggaa
aacaccgcggcctcggcctccagaaaccccggccttgcgcaatcccccgcagcccgcgcc
tccctgggccccacgcggtgcactcaccacccctggggtttttccctctcttccccacag
GTTCCTGCACTTGGCCATCATCCATGAAGAAAAGGCACTGACCATGGAAGTGATCCGCCA
GGTGAAGGGAGACCTGGCCTTCCTCAACTTCCAGAACAACCTGCAGCAG
gtgcgccgcttgcctggcccgggttctctctgaccctgggacgtagctgatgtagcagag
tcaccccagatcctttctgaattcagggccactgagcactatttaccctcaccttttact
tcacatcagcccacatcctagagagtgaaggaaattccactgatttggtgaggtctttat

 1.03 Intr +   2579   2789  211  1  1   91   80   146 0.992  13.11
ggaaattccactgatttggtgaggtctttatgacccacctggagcctctgctatttgcca
gccctccccacccccctgtctaggaggagcagcacccaaccaggagacacgggttgaggg
gaactcggggtgtgggtttggtccatggcttactttctctggtctctcttgcattcgtag
ACTCCACTCCACTTGGCTGTGATCACCAACCAGCCAGAAATTGCTGAGGCACTTCTGGGA
GCTGGCTGTGATCCTGAGCTCCGAGACTTTCGAGGAAATACCCCCCTACACCTTGCCTGT
GAGCAGGGCTGCCTGGCCAGCGTGGGAGTCCTGACTCAGTCCTGCACCACCCCGCACCTC
CACTCCATCCTGAAGGCTACCAACTACAATG
gtatgtctgcctccctgccctgccccaccccctcggagggcaggtgacgtggagaagggg
caggtgggccaacttaaggagtccaggcaagagcttaaactcctaacatttggaaggttg
agaaaatatgtgtgcaaagtgcctattggatgcctttataaagttctttcagaacccaga

 1.04 Intr +   3080   3168   89  0  2  105   77   115 0.916  12.29
tggaaggttgagaaaatatgtgtgcaaagtgcctattggatgcctttataaagttctttc
agaacccagactgtgggttcttaaaattcagaagataagactacttgttccataaaagaa
taggtgaaaggagtgagggttgaaacaggtggttatacttttttccttttgttcttccag
GCCACACGTGTCTACACTTAGCCTCTATCCATGGCTACCTGGGCATCGTGGAGCTTTTGG
TGTCCTTGGGTGCTGATGTCAATGCTCAG
gttggtgcttcctgcccccgacgcactgagtcaggctcctcgtgcttatgttgtgagcag
aaattccaaatgcagccataagcatctcaaattccttttggtttcaggagccctgtaatg
gccggactgcccttcacctcgcagtggacctgcaaaatcctgacctggtgtcactcctgt

 1.05 Intr +   3276   3545  270  2  0   76  105   304 0.896  29.18
cttagcctctatccatggctacctgggcatcgtggagcttttggtgtccttgggtgctga
tgtcaatgctcaggttggtgcttcctgcccccgacgcactgagtcaggctcctcgtgctt
atgttgtgagcagaaattccaaatgcagccataagcatctcaaattccttttggtttcag
GAGCCCTGTAATGGCCGGACTGCCCTTCACCTCGCAGTGGACCTGCAAAATCCTGACCTG
GTGTCACTCCTGTTGAAGTGTGGGGCTGATGTCAACAGAGTTACCTACCAGGGCTATTCT
CCCTACCAGCTCACCTGGGGCCGCCCAAGCACCCGGATACAGCAGCAGCTGGGCCAGCTG
ACACTAGAAAACCTTCAGATGCTGCCAGAGAGTGAGGATGAGGAGAGCTATGACACAGAG
TCAGAGTTCACGGAGTTCACAGAGGACGAG
gtgagtctgtgaactccttcggcgctctaactaatgaggtgccattcccttcaccctccc
aggcccctagagctgctccttatcagaggggtatctacataatgagtctctcaaatttct
gtgcataaccagtatcccaagaatgtacctgccccccctctttttttaaagagaagcatt

 1.06 Term +   3879   3926   48  2  0  107   53    58 0.950   1.79
ccccctctttttttaaagagaagcattaaaggcaaactctctcagcctgtaaagttcatt
atatttgggctatggagaatggagtccaagagttatttccagtagtggcctccccatccc
ggtagcttggcagagctccgctccggaagcttaacgtgtcttttttccccttgttttcag
CTGCCCTATGATGACTGTGTGTTTGGAGGCCAGCGTCTGACGTTATGA
gcgcaaaggggctgaaagaacatggacttgtatatttgtacaaaaaaaaagttttatttt
tctaaaaaaagaaaaaagaagaaaaaatttaaagggtgtacttatatccacactgcacac
tgcctggcccaaaacgtcttattgtggtaggatcagccctcattttgttgcttttgtgaa

Predicted peptide sequence(s):


>NFKBIA_1|GENSCAN_predicted_peptide_1|393_aa
QRTKPVLFFWSDWLGNSPSLTPPQRNPQPAFIGRRGGAAEPTAVRAAVPPASAPARKQRA
ARGPAHPQQRPQLVRAMFQAAERPQEWAMEGPRDGLKKERLLDDRHDSGLDSMKDEEYEQ
MVKELQEIRLEPQEVPRGSEPWKQQLTEDGDSFLHLAIIHEEKALTMEVIRQVKGDLAFL
NFQNNLQQTPLHLAVITNQPEIAEALLGAGCDPELRDFRGNTPLHLACEQGCLASVGVLT
QSCTTPHLHSILKATNYNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLA
VDLQNPDLVSLLLKCGADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESE
DEESYDTESEFTEFTEDELPYDDCVFGGQRLTL