GENSCAN 1.0	Date run: 15-Jan-104	Time: 07:37:25

Sequence MPP5_1 : 43756 bp : 36.58% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +   1106   1314  209  0  2   85   87   129 0.616  10.37
tttttaaaagagttttacttaaaacctatgaaatgaccatgattgacaataatatatgca
gattttggtatttttctgaaaacttaaattgttactggttcaaagaaatgttctctgaaa
atgcatgttgaattaatactgaaacagttaatttttggataccttttcttcttctactag
AAATAGAAGACTTGTTTTCTTCACTTAAACATATCCAACATACTTTGGTAGATTCTCAGA
GCCAGGAGGATATTTCACTGCTTTTACAACTTGTTCAAAATAAGGATTTCCAGAATGCAT
TTAAGATACACAATGCCATCACAGTACACATGAACAAGGCCAGTCCTCCATTTCCTCTTA
TCTCCAACGCACAAGATCTTGCTCAAGAG
gtatgtattctaaacatcttgttgatgtctacaaggtaattagtagtggcaggaaggcag
gattattggaaaatactaatgtgactataagatttgtttgaattaattactgttaattac
atgttaataatgtattgtgacagtttactacatgcattttatcctaaaaacaaaaaaagt

 1.02 Intr +   9984  10061   78  2  0   63   75    67 0.561   1.73
aatactgttgttttatccataataacaagattgaaaactctaataattctttttagtgat
tttatttcttacaagtatttttattattttaatttgtacttaaaaaatatgaccctgcat
acaggtgctactgatacttcctataatctaggaagaataatctttatttttgtttcttag
GTACAAACTGTTTTGAAGCCAGTTCATCATAAGGAAGGACAAGAACTAACTGCTTTGCTG
AATACTCCACATATTCAG
gtagaaaatggacagaatactatatatgtggtttttccagcattcttctatttttttaaa
tcaaagactccagtactggaagagatgtcaaacattctctagcctattttgatgtttaca
accccatctataacatagtagttattgttggattatatattttcagatttaaaatgaacc

 1.03 Intr +  10567  10713  147  0  0   47  111   201 0.726  17.81
tttcataacccattccagagtatgcccttagtatacttaacacatctttattattagctc
taattaattataacacttttaaagatttaatggtcagaatactatgtacataggttaaaa
atcactctgcagaaataaatcatgctgttacttaaaatgccatggatttctttgaaacag
GCACTTTTACTGGCCCACGATAAGGTTGCTGAGCAGGAAATGCAGCTAGAGCCCATTACA
GATGAGAGAGTTTATGAAAGTATTGGCCAGTATGGAGGAGAAACTGTAAAAATAGTTCGT
ATAGAAAAGGCTCGTGATATTCCGTTG
gtaagtgtcccacatactgtttttaaacaagtgcatttttctgctgttgtgtgcttcaaa
agtctggttaatttcagaattctaatgaatagagtatttctgaagcagaaagtgtggggg
aaatggtcaacttttaaatctaattacaattactctagttgtgtaaataaattttttctt

 1.04 Intr +  11005  11166  162  0  0   50  111   187 0.999  16.45
gtgtgggggaaatggtcaacttttaaatctaattacaattactctagttgtgtaaataaa
ttttttcttaagataactgaaggttagtattgttgaatggaaaaaatagaatttaaaaat
aaatgcttaacaaaaattgtattatttttatttttaaattatacatatatatatttttag
GGTGCTACAGTTCGTAATGAAATGGACTCTGTCATCATTAGCCGGATAGTAAAAGGGGGT
GCTGCAGAGAAAAGTGGTCTGTTGCATGAAGGAGATGAAGTTCTAGAGATTAATGGCATT
GAAATTCGGGGGAAAGATGTCAATGAGGTTTTTGACTTGTTG
gtaagttgacgcagctagaagaataattgatagcttttagaaagctcttattagacttta
gaataaaatatttttaaaataactgttaagagcactagatgatttctagcctgatttttc
catgatgtaactgttccacagtatttgttagcagttttatttttgggtggtaccactgat

 1.05 Intr +  21122  21305  184  1  1   99  110   143 0.998  16.04
ggagaaggatcgcttgaggctagaaatttgagattatcctggacaacatactgagatgct
gtctctattaaatttttttaaaattaaaaaataataaaaaatttgtagcatttaaattgt
attcatatgaaacattttatattgccatttattgttgtttttgccctttttatcttttag
ATCCATGTAAAAGCTCATTTTGACTATGACCCCTCAGATGACCCTTATGTTCCATGTCGA
GAGTTAGGTCTGTCTTTTCAAAAAGGTGATATACTTCATGTGATCAGTCAAGAAGATCCA
AACTGGTGGCAGGCCTACAGGGAAGGGGACGAAGATAATCAACCTCTAGCCGGGCTTGTT
CCAG
gtaagacacaatatggtagaaagtacataatattaaaagaacattgaaaatgcaagcctt
cacaaagaaaaactcactctttcatgcctctatttaataaagtattccagttactttttc
gtgtagttgggtttttatgttgtacctgcagcgtaagtatattaaatagaatgtggccaa

 1.06 Intr +  25427  25498   72  0  0   73   66    76 0.833   2.36
atattttaaaaatttggaggcttacacatcatagctgacattactcctgtgttggcaaaa
ggatttggaagggaatataagtgaagagatatgtctagtgttttcccttcttgattaaaa
aaaaaattcttatccttttatcttaaatattttacccttctttttctttctgctattaag
GGAAAAGCTTTCAGCAGCAAAGGGAAGCCATGAAACAAACCATAGAAGAAGATAAGGAGC
CAGAAAAATCAG
gttagacacttgtatttgacataagtaaatggtttcttgggtcttcatctggagccatgt
gtgaatctgcatattagaaccgtgaagaagtactcagggaaagagtgatacaagaggcaa
aactgattatctcagaactgtaaagaaaggataagatttaagtattaaagattatctgtc

 1.07 Intr +  26003  26074   72  0  0   52  115    42 0.764   1.76
tgaggcgggaggatcacttgaggccaggagttcaagacaagcgtggccaacatatggaga
tctcgtttctgcaaaaaaatttaaagaataaatgaatgaataaatagagttcttcaattt
gagttatgtggttttgttcacgggaacacatttatagttatgtttatgattgctcaacag
GAAAACTGTGGTGTGCAAAGAAGAATAAAAAGAAGAGGAAAAAGGTTTTATATAATGCCA
ATAAAAATGATG
gtaagttctactctcagggataggtggaattatatctgaaaggagtctaaacctagtcct
gttttgcaccttaatgttaaatatgtgcttgagaaaatcatttagtagaaagtattttct
tttggaatcctgtgagtaaggcagtgttttgaattctggggaaaactgatacaaaaattc

 1.08 Intr +  28825  28992  168  2  0   50   99   189 0.999  15.20
ataaaaattaatagaaggagtattatattgttgtctgattcattttcatgataccctagc
aaggatgtaatgacaataaattgtgcttttgtctaattttgggtgaagatctatgagtat
ttatatctttaatacatggccataattttgtttgaagagcttaacttttttttcccaaag
ATTATGACAACGAGGAGATCTTAACCTATGAGGAAATGTCACTTTATCATCAGCCAGCAA
ATAGGAAGAGACCTATCATCTTGATTGGTCCACAGAACTGTGGCCAGAATGAATTGCGTC
AGAGGCTCATGAACAAAGAAAAGGACCGCTTTGCATCTGCAGTTCCTC
gtaagtttgaatgcattcccattttcctgtgcttttcaatttaccagctcagaacctaac
tatatcatgtagggaaattttttattcatttcattaaaacactgttgtcagtgaaagagg
aactttaaccaaagattttgacaatttttaaattaaaaatagtcattattaagaaattta

 1.09 Intr +  29652  29854  203  1  2   67  103   200 0.999  17.48
gttcatttttcaatctacaaaaaataaaaacaatgttaaacatgtaggcacttagcattt
tctcagtttattattttataatctgtgttacaaaatagaaattctttctgactagcagaa
ttatcccctgtcctcactctaagccatgcctgttatttctatctgattttgtttgcctag
ATACAACCCGGAGTAGGCGAGACCAAGAAGTAGCCGGTAGAGATTACCACTTTGTTTCGC
GGCAAGCATTCGAGGCAGACATAGCAGCTGGAAAGTTCATTGAGCATGGTGAATTTGAGA
AGAATTTGTATGGAACTAGCATAGATTCTGTACGGCAAGTGATCAACTCTGGCAAAATAT
GTCTTTTAAGTCTTCGTACACAG
gtaaagctagaactttgttttagggtttgaacttagaaggaatgtcatatagagtaatct
agtggaagctatattttggtccaagaacagcgcgacctaattaagttctcatacggtttt
tcccactgatttgctatctgaaatcacacaggttgctaaatctctttcagtttcctcaga

 1.10 Intr +  32297  32407  111  1  0   58   98    93 0.869   6.96
aggggccacttgagtgcagcagattgaggttgcagagagctgtgatcacaccactgcact
ctagcctaggcaacagagcaagtcccttaatctaatatatatatatatatatatatcagt
attattaggaagtaattaaatgatgcaaattattttaaaaatcaaaatgtctctttacag
TCATTGAAGACTCTCCGGAATTCAGATTTGAAACCATATATTATCTTCATTGCACCCCCT
TCACAAGAAAGACTTCGGGCATTATTGGCCAAAGAAGGCAAGAATCCAAAG
gtaaagttttcacactattgtactattccattgaaggtaaacatgaaacagtcctggtct
aatttgtcctggtgcttaaaagctacattagcttgagctttcaaactgattattttttct
gtaatattacttgcccaaaaattgccatggttgccactgggttggactatggcagctttc

 1.11 Term +  41375  41551  177  1  0   82   48   102 0.435   2.30
agatgccaaagcaaaggtaaccattgtggccgtgacagggttggaaaggagctcctgagg
ttgggagagacagaaggaaagctatgaaggtcgctccttgttctttggccatctctgact
catcctatattatttggttaggaaaggaattatctcacagtttttatcttctgtttgcag
CCTGAAGAGTTGAGAGAAATCATTGAGAAGACAAGAGAGATGGAGCAGAACAATGGCCAC
TACTTTGATACGGCAATTGTGAATTCCGATCTTGATAAAGCCTATCAGGAATTGCTTAGG
TTAATTAACAAACTTGATACTGAACCTCAGTGGGTACCATCCACTTGGCTGAGGTGA
aagaaacatccattctgtggcatgttggacttgatctggcaaaaactgccaataggagga
ctgcccgacactgcagcaagattgaggataagatggaaggcagcagtataagctgtagat
ctgttcttagatctcttgaattagtgagacgacagttcccttaggcagtttgtgcatggc

Predicted peptide sequence(s):


>MPP5_1|GENSCAN_predicted_peptide_1|527_aa
XIEDLFSSLKHIQHTLVDSQSQEDISLLLQLVQNKDFQNAFKIHNAITVHMNKASPPFPL
ISNAQDLAQEVQTVLKPVHHKEGQELTALLNTPHIQALLLAHDKVAEQEMQLEPITDERV
YESIGQYGGETVKIVRIEKARDIPLGATVRNEMDSVIISRIVKGGAAEKSGLLHEGDEVL
EINGIEIRGKDVNEVFDLLIHVKAHFDYDPSDDPYVPCRELGLSFQKGDILHVISQEDPN
WWQAYREGDEDNQPLAGLVPGKSFQQQREAMKQTIEEDKEPEKSGKLWCAKKNKKKRKKV
LYNANKNDDYDNEEILTYEEMSLYHQPANRKRPIILIGPQNCGQNELRQRLMNKEKDRFA
SAVPHTTRSRRDQEVAGRDYHFVSRQAFEADIAAGKFIEHGEFEKNLYGTSIDSVRQVIN
SGKICLLSLRTQSLKTLRNSDLKPYIIFIAPPSQERLRALLAKEGKNPKPEELREIIEKT
REMEQNNGHYFDTAIVNSDLDKAYQELLRLINKLDTEPQWVPSTWLR