GENSCAN 1.0	Date run: 15-Jan-104	Time: 07:36:59

Sequence MAX_1 : 29782 bp : 43.97% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1371   1406   36  2  0   46   86    90 0.718   4.61
gcagtgaggaggtggttcttgcccgtgttgtgtgtgtgtgtgagtgagagagcgagtgag
tgagtgagtgagtgtgtgtgtgggggggactcggcttgttgttgtcggtgacttccccct
ccccttcaccccttcccctccccgccgccgctgcagtggccgctccctgggccgtaggaa
ATGAGCGATAACGATGACATCGAGGTGGAGAGCGAC
gtgagtcctggggcttcttccttcccgtgcgggttgtcaggcggggacagcggccggggc
tcttagcggggcgacggcgggagggggccgggctgccgccgcctccttccccttcccctc
ggggccaggagtgcctccgtcgcgttcccggttcgctcccctccggctcctggccggagc

 1.02 Intr +   9895  10002  108  0  0  115  113    58 0.987  11.48
ttctccccctttagcagagcctaattctggagactcctaactgcccacctcgagaaatcc
ttcccagtccactcgccagggacagtgctgacagcgtgtacttccaggctgtaccccacc
caccttgtaccaagcaaaaggagtgacattcctaatgtgttctttctcccattcttctag
GCTGACAAACGGGCTCATCATAATGCACTGGAACGAAAACGTAGGGACCACATCAAAGAC
AGCTTTCACAGTTTGCGGGACTCAGTCCCATCACTCCAAGGAGAGAAG
gtgagtttcctgagaaagctgagtagctggccactactagcttggaacttgttgcagagc
ttagcagagcactcacctattgggaaggaaatgtagtcagagatattcaggtagcatggt
tgccttatttttgactgtttggaggatcactgcacaccttacgtactccagtttatcctt

 1.03 Intr +  25674  25797  124  2  1   80  105   151 0.923  16.16
aaaaataaaaaaataaataaataaataaagcctacagtagccattattgtatttcttcag
ccttttcccaccttaccctctcgtttccagccacccaagcagttgctgcaggccaggttc
cctcactgcctggattgggtttttattttgtcccctgtgctttttctcatattgccacag
GCATCCCGGGCCCAAATCCTAGACAAAGCCACAGAATATATCCAGTATATGCGAAGGAAA
AACCACACACACCAGCAAGATATTGACGACCTCAAGCGGCAGAATGCTCTTCTGGAGCAG
CAAG
gtgagcacccgagctcgtggggcagctggccctgctgtgctccagccaggtcaggctttg
gcacctgggcctgcagagtcagagccagtcatggagtatgtgctcagtagcaggcttggt
cctgcttcttggggcctgagtaactgagtgttagagccgtcctgaggaaggacctgaggc

 1.04 Term +  27047  27234  188  0  2   68   46   266 0.993  18.05
cgggagggaaatgaagtgtgtgagtgaacagccacccgaagggagctacttctgagcatc
ttgagcctcgggggccaacaagcaagcccttaggaagaacaggctggaccctgagtctga
gactcggttactccccaagtctccagaaggcagtaacacactcccttggttgccttttag
TCCGTGCACTGGAGAAGGCGAGGTCAAGTGCCCAACTGCAGACCAACTACCCCTCCTCAG
ACAACAGCCTCTACACCAACGCCAAGGGCAGCACCATCTCTGCCTTCGATGGGGGCTCGG
ACTCCAGCTCGGAGTCTGAGCCTGAAGAGCCCCAAAGCAGGAAGAAGCTCCGGATGGAGG
CCAGCTAA
gccactcggggcaggccagcaataaaaactgtctgtctccatcgtctcatcctcctttca
gttcgttggtagagccctcagaaccatttaagagactctttatttttctctttctccctt
ttttttttaaatttttatttttacgtagaagctcttggacaacagctctcgttctccttc

Predicted peptide sequence(s):


>MAX_1|GENSCAN_predicted_peptide_1|151_aa
MSDNDDIEVESDADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASRAQILDKATE
YIQYMRRKNHTHQQDIDDLKRQNALLEQQVRALEKARSSAQLQTNYPSSDNSLYTNAKGS
TISAFDGGSDSSSESEPEEPQSRKKLRMEAS