GENSCAN 1.0	Date run: 15-Jan-104	Time: 06:56:07

Sequence HECTD1_1 : 109599 bp : 39.49% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +    521    681  161  1  2    0   37   239 0.870   7.86
cgcgaggagggaagatcgtggctgagtgcgggtggcctgggcggaaggctcagcggggac
aggttgggccgcagctttgctgtgctgtgccgtgcgacgccctccgcaggagcgcgcaaa
gtgttagccacggcgccaagcaagctggacgtgcgtgcatgagcgcgctcggactgacag
GGAAGCGAAAAGGGGGCCAGGGCGCACCATAGAAAAGCCGCGGCAGAAACGTACGACACA
GCCCGAGGCGGCGGGGGCGAGAGCTCCGGGGCAGGGACGGCGACGCGGCGTACCCGGTTT
GGCGCCCCTGCGCGGCGGTCGGCCGTCCCGCAGCGCCCCAG
gtggccgccggcggggtcgccgccgggggagtggatttgctccgcctccgccgggctcgg
ctgccctcggcagcttccccgcctggctctccctcgaccctcctcccctccccctcccgg
ttcgcgatggactgggcctccccgccgcgccgccgccgccgtcgcccgcagcaccgcgcg

 1.02 Intr +    853   1127  275  1  2   86   54   295 0.163  22.16
gcgccccaggtggccgccggcggggtcgccgccgggggagtggatttgctccgcctccgc
cgggctcggctgccctcggcagcttccccgcctggctctccctcgaccctcctcccctcc
ccctcccggttcgcgatggactgggcctccccgccgcgccgccgccgccgtcgcccgcag
CACCGCGCGGGCCTCTGAGTTGCAGGGCCTGAGGAGCCGCGTGCTGGGGACTGGACGTCC
GCTGGCTGCTGCCGCACGCGAGAACCTCTCGCTTCCCTGTCACCAGGTCCTCGCGGAGGA
AGGGGAGGGACGAGGCGCGGCTTTTCCTGTGCCGCCTGCCCGGTTCGACCTGCGCGGCCT
GCGGCTTCTTGGGAACTCTAGGGCCGCGGCCGGGCCTGGCTCTGCCGGCGGCCTGTTGGG
AGCTGGATCGGAGCGGTTTGGAACGACAAGCCCGA
gtaagagcctgcgggaaggggaggcgggagcgcctcggaccgtcggaagggccctgcgtg
ggggcgcggatcccggacgcccggcgagtggcggaaagcgagaccccggcgccgagtgag
gtcggccaggctgctgccgacttccccgctggcccctttgttcccctcccggggccctgc

 1.03 Intr +   2589   2721  133  1  1  -37  111   139 0.073   2.48
tacgtccaaacgtacttaggagtcttttttaattgctaggaggacactatgaaaatttgg
ttctagcagatgtaaaggaagaaaaatttaagcccaagctgttcagtcccggaatttaaa
ggacttttctccctttacttttcaaatttaagcaaagagacttttaaaaaaccatggcag
ATGTGGACCCAGATACATTGCTGGAATGGCTACAGATGGGACAGGGAGATGAAAGGGACA
TGCAACTAATAGCCCTTGAACAGCTATGCATGCTGCTTTTGATGTCTGACAACGTGGATC
GTTGTTTTGAAAC
gtaagtacattccttcatcatgttcctttgggttactgtagtgacatctgttttcaacca
tttgctgacttcagtttgtgtagaaatttctctagtgaattttaacacgtatctttaaaa
atattcctgaagagttttgtgtttacacttttccaagaaataaaaattggtaggtgaaga

 1.04 Intr +  30264  30498  235  0  1   89  115   194 0.351  18.97
tagcatgtgagtattgttatggaagcaaaaacaatgtgagaaatattacctaataaacat
tcagacacagtattgagcacagtgtgttacattataactttttattttctattattttgt
taatattttgctgttaagaatttaataaccctagatgtaatatgatttctttcactacag
ATGTCCTCCTCGCACTTTCTTACCAGCCCTTTGCAAAATTTTTCTTGATGAAAGTGCTCC
AGACAATGTATTAGAGGTGACAGCCCGTGCCATAACATACTACCTGGATGTATCTGCGGA
ATGTACCCGAAGGATTGTTGGGGTAGATGGAGCTATAAAAGCACTTTGTAATCGTTTGGT
TGTAGTTGAACTTAACAACAGGACTAGCAGAGACTTAGCCGAACAGTGTGTAAAG
gtaagtattacttattggctcattacttatttttctcagacctctcagggatgagtattg
gctcatttaaacatcacttagagactgaaaaatgtatttactaaaaaaaaaaaatttcta
aaaaaaaaaattcttcctatcttcagtcttactttattgagagtagttgagaacagtgga

 1.05 Intr +  33380  33607  228  1  0   78   99    78 0.944   5.04
agtgctgggatcacaggtgtgagctaccacacccatctaaaatgtattattaaaattaat
ttcatttgtttcacttttctgtttttaatgtgtcactaataaatttggagagcgcattgt
ttctgtgattcttgaaaatcaggcttgcattctttcgttacatttgttttactattatag
GTATTAGAACTGATATGTACTCGTGAGTCAGGAGCAGTCTTTGAGGCTGGTGGTTTGAAT
TGTGTGCTTACCTTCATTCGTGACAGTGGACATCTAGTTCATAAAGACACCTTGCACTCT
GCTATGGCTGTGGTATCAAGACTCTGTGGCAAAATGGAGCCTCAAGATTCTTCTTTAGAA
ATTTGTGTAGAATCTCTGTCTAGTTTATTAAAGCATGAAGATCATCAG
gtaaataagttgctgttacatactttccattttcagaaagtgatttttttagtgttcccc
tgtttataattatgatagactgtaatttgtgcttttcacttgatgaaatcgaggtaattc
catcctctttctctaattttatctctgcatgtggtaatctccattttgggaatgaaactt

 1.06 Intr +  34712  34945  234  1  0   28   87   247 0.612  15.56
agtttaagtaacttcctcggattacacagttagcagtatatggagccacgattcaatagg
cagatcacatgcttaatcactttgctgcagttgcctttcttatagtgtcagtattgaaat
gatcattactaaccctttttaggtggattttatctgtgggcattttcttcacattgttag
GTTTCAGATGGAGCTCTGCGATGCTTTGCATCACTGGCTGACCGATTTACCCGTCGTGGT
GTTGACCCAGCTCCATTAGCCAAGCATGGATTAACTGAGGAGCTGTTATCTCGAATGGCT
GCTGCTGGTGGTACTGTTTCAGGACCATCATCAGCATGCAAACCAGGTCGCAGCACCACA
GGAGCTCCATCCACCACTGCAGATTCCAAATTGAGTAATCAGGTGTCAACAATT
gtaagtctgctctcaacactttgcagaggctctccggtagtaacacatgtaagaatgttt
ttgaatctttgctttttaatcttcagaaaaagtgtttttgtataatgctaatatattaaa
catctttcttcccattctctttctaggatcttctgaggtcggagcttccagattcaattg

 1.07 Intr +  35092  35362  271  0  1  122   55   273 0.999  23.59
agattccaaattgagtaatcaggtgtcaacaattgtaagtctgctctcaacactttgcag
aggctctccggtagtaacacatgtaagaatgtttttgaatctttgctttttaatcttcag
aaaaagtgtttttgtataatgctaatatattaaacatctttcttcccattctctttctag
GATCTTCTGAGGTCGGAGCTTCCAGATTCAATTGAAAGTGCATTGCAGGGTGATGAAAGA
TGTGTGCTTGATACTATGCGTTTGGTTGACCTTCTCTTGGTGCTATTATTTGAAGGACGA
AAAGCTTTGCCAAAGTCTAGTGCTGGATCTACAGGCAGAATCCCAGGACTCCGGAGATTA
GATAGTTCTGGGGAGCGCTCACATCGGCAGCTTATAGATTGTATTCGAAGTAAAGATACC
GATGCACTTATAGATGCAATTGACACAGGAG
gtcagaaaatatttttttaaatataaaaagaaagttgtgagataaccatataggcagttt
ctagttttcggacagtactcttagaaatccagataacaaagtggcaccccttcgatattc
tcccctatccctgtgcataattatgtaattatcagcttggttcttggtgaaacctgaata

 1.08 Intr +  36396  36472   77  1  2   53  103    44 0.997   0.72
tgatctcaagtttgctgattatgtactgctctatagttgacctaaatatttaaaacactc
tcttggctctttatttagatgatgactaatgacgatcttaaaatggttcagtctttagaa
aagtttagtattttattggctttaaaaatacgtttctttttttttccttcaaaatttcag
CCTTTGAAGTAAATTTTATGGATGATGTAGGTCAGACTCTATTAAACTGGGCCTCTGCTT
TTGGAACTCAGGAAATG
gtaagctaataaataaaagctggtatttaaattaaggatagaaatattaataaaaagcag
ctttatgattcgttatcattttacaggtagaatttctttgtgagagaggtgcagatgtta
atagaggtcaaaggtcatcatcattacattatgctgcatgttttggaagacctcaagtag

 1.09 Intr +  36559  36657   99  0  0   95   98     7 0.774   1.79
ttccttcaaaatttcagcctttgaagtaaattttatggatgatgtaggtcagactctatt
aaactgggcctctgcttttggaactcaggaaatggtaagctaataaataaaagctggtat
ttaaattaaggatagaaatattaataaaaagcagctttatgattcgttatcattttacag
GTAGAATTTCTTTGTGAGAGAGGTGCAGATGTTAATAGAGGTCAAAGGTCATCATCATTA
CATTATGCTGCATGTTTTGGAAGACCTCAAGTAGCAAAG
gtaaagtctaggttttaaaattactaatttttaacatttacatggtttaaaaattagaat
gatataaaaccttttatttccatgccatctccatccacttcattcccccttactcactgt
aagtgtttttaattagttttttctttttagtgtttcctaatacagattcaataaaaacaa

 1.10 Intr +  39050  39164  115  1  1   69   94   155 0.999  13.30
tcggcctcccaaagtgctgagattacagaataggctgcttttaaggtactaagtgcaaag
gcagagatatggattgccacctgcttgattaagtaattctggaaaatctttagtttacat
agttggatgtcaaagaaataaagtattgttatattcaaattaaatgcttttcttctctag
ACTCTGTTACGGCATGGTGCAAATCCAGATCTGAGAGATGAAGATGGGAAAACTCCATTA
GATAAAGCTCGAGAAAGGGGCCATAGTGAAGTGGTAGCTATTCTTCAGTCTCCAG
gtgagagctacattctttcttttgaagccatctactgttatttttcagctttcacttcca
tagctttctgtagacacattaaccttatataaatgaactattcctatgaagtcaaataat
tatatatgtatatccttatatttaataaacctgtttaacagcttaattttctatgttctt

 1.11 Intr +  40046  40220  175  0  1   43   63   127 0.855   3.78
acattgaagttactagtgctctttagtattcttataagcatcattgaaacaatgttctaa
tttcagtgtatttgttaattagagataattattatttgaagttggatatatcttaaggtt
tttttccttgaaagcaaaagtttccaaaaaagtatttctttaaaaaatatttgtctgtag
GTGATTGGATGTGTCCAGTTAATAAAGGAGATGATAAGAAAAAGAAAGATACAAACAAAG
ATGAAGAAGAATGTAATGAGCCCAAAGGAGATCCGGAAATGGCACCCATATACTTGAAAA
GGTTATTGCCAGTGTTTGCACAAACATTTCAGCAAACTATGCTGCCTTCAATAAG
gtagttattcatactatttgatgtgttagtcaaattacaccaattatatggttttattta
tctcccttttccagaagtatttgaggtttattttaatgttaaaaaggtgtggtaagaata
aaatttagatgagaagtgggaaagccctatcttttcttctgacgatctgaacgaagagaa

 1.12 Intr +  51215  51353  139  2  1   75   65    52 0.957   1.15
attatttcaaaaatgaacatatagtgctgagtcccaattttttgtatttttttattaagt
gtatttttttagcagagtgtataaaatgtaacattggatattttactgttcattaatgca
tgcattttgatttattttaacttcatttggcttcatataattctatttttacttttcaag
GAAAGCAAGTCTTGCTCTAATTCGAAAAATGATTCATTTTTGCTCTGAAGCACTGTTAAA
AGAAGTTTGTGATTCTGATGTTGGTCACAATTTGCCTACAATACTAGTGGAAATCACTGC
AACTGTCCTGGATCAAGAG
gtccgtttctttttcaaaactctttagcattaatttcctttagctagtagtctgaaataa
aatttttgttttaatttcagtaaatcatgttgtgcaaattactgcatttctctactcctg
gcaactaaacttatttttattttttatttttcaggatgatgatgatggccacttgctggc

 1.13 Intr +  51508  51678  171  0  0  125   87   160 0.978  18.82
tcactgcaactgtcctggatcaagaggtccgtttctttttcaaaactctttagcattaat
ttcctttagctagtagtctgaaataaaatttttgttttaatttcagtaaatcatgttgtg
caaattactgcatttctctactcctggcaactaaacttatttttattttttatttttcag
GATGATGATGATGGCCACTTGCTGGCTTTGCAGATCATAAGGGATTTAGTAGATAAAGGT
GGTGATATATTTTTGGATCAGCTAGCCAGACTTGGTGTAATTAGCAAAGTGTCAACGTTG
GCAGGTCCTTCCTCTGATGATGAGAATGAAGAGGAATCAAAACCAGAAAAA
gtgagtggtcttaattatagaggtatcaggaagagttttttttttttttttgaggaaaat
ctagtttcaatttttgatggtttttgacaggataatgacaatatgaaataattctgtata
ttttttaaattggtcaattttcttttaaaacattttgatcaacaattttaaacatataga

 1.14 Intr +  58297  58519  223  0  1   38   90    82 0.546   0.18
atgacagagttgagaccatgtttctaaaaggggggaaaaagattaagctacaggcaattg
agtattatgttcagagtatttaaatttgaaattaaattagattcatgtttttaaaatatg
tatgaatatttgaaattgaaattattttccatgtttaattgaataattctacacatttag
GAAGATGAACCACAGGAAGATGCTAAAGAATTGCAACAAGGTAAACCATATCATTGGAGA
GACTGGTCAATCATTAGGGGAAGGGACTGCTTATATATTTGGAGTGATGCAGCAGCCTTG
GAATTATCTAATGGCAGTAATGGATGGTTCAGATTTATCTTGGATGGAAAACTTGCCACC
ATGTATTCAAGTGGTAGTCCGGAAGGTGGATCTGACAGTTCAG
gtaatattttgtttcaattaaaatattttcctagtttctacagtttggtttttttctcat
atttttgctaccattgtcaaggtattttatttttttgagacggagtctcactctgtcacc
caggctggagtgcagtggtgcgatctcggctcactgcaacctccacctctcaggttcaag

 1.15 Intr +  59358  59621  264  1  0   52  106   218 0.994  16.56
ttagcttcccaagtagctgggactacagatgcgtaccaccatgcctggctaatatttcca
gtttctaatttagttttattgtttaaaatttatattttaataggtctttttttcctaaga
gaaaatacatgtcatacttgaaagaaataagattttgaaacaagtattttgtctttatag
AAAGCCGAAGTGAATTCTTAGAGAAGTTACAAAGAGCTCGAGGCCAAGTAAAGCCATCTA
CTTCAAGTCAACCTATACTGTCAGCACCAGGACCCACTAAACTTACTGTAGGAAATTGGT
CACTGACATGTTTGAAAGAAGGAGAAATTGCTATTCATAATTCAGATGGTCAGCAAGCTA
CAATATTGAAAGAAGATTTACCTGGTTTTGTATTTGAATCTAATAGAGGAACCAAACATT
CATTTACTGCAGAAACTTCCCTGG
gtaagtatgtagatatgtaagtttattgggtacaaataaatgaatatgttaaattgtaac
aaagtaagctctgtgaatattcttttttttccccccaaggttcagaatttgtgactggct
ggactggcaaaagaggcagaaaactgaaatctaagttagaaaaaacaaagcaaaaggtat

 1.16 Intr +  59721  59797   77  1  2   95   71    26 0.983  -0.08
tattgaaagaagatttacctggttttgtatttgaatctaatagaggaaccaaacattcat
ttactgcagaaacttccctgggtaagtatgtagatatgtaagtttattgggtacaaataa
atgaatatgttaaattgtaacaaagtaagctctgtgaatattcttttttttccccccaag
GTTCAGAATTTGTGACTGGCTGGACTGGCAAAAGAGGCAGAAAACTGAAATCTAAGTTAG
AAAAAACAAAGCAAAAG
gtatatctgttggatgtgctttattcttgtcttttatactgatttgttaaattttcagtg
gtaaagtataagcactgaaaaaaattgagccatagaacataagcagccctaatataatat
atttttagtttttctattttctgtgttttcttaaatatttatttacatataatttttata

 1.17 Intr +  63577  63711  135  0  0   78   55    90 0.919   4.54
cagaacatacataggttgtttcctcaaataactgtaacttcgagagctcatttgtgccca
aatgacagtacatacgtaccttttcgtggtgaaatatgtaaatacgagtgtctataaaag
tgaagatttggtaaaattattaattgtaaaaattcacatttgttgtgtttattttggtag
GTACGAACTATGGCTCGAGATTTATACGATGACCATTTTAAAGCTGTTGAAAGCATGCCT
CGTGGAGTAGTGGTAACACTCAGAAACATAGCAACTCAGTTAGAGTCATCTTGGGAACTT
CATACAAATAGACAA
gtatgtcatcctctagattttaatgatatgtagtgaattttagtttgatgtcttcccctc
tatcctttatgtcatgggtattgagtagggggtcagcaaattatggcccaggagccaaat
ctggcctgctccccattttcgtatggctttatgaggtaagaatggtttttatacttttaa

 1.18 Intr +  64261  64407  147  0  0   90  101    91 0.998  10.11
actgggccctttacgaaaacgtttgctgacctctggtagacataatttgtgttaataatt
tgaacttttaattttgcttaatatctaaattattgtcatgataattgatgttctgataag
ttattttaagagctatgtttatgtttttgattgccttcattaaatttttttttcttttag
TGTATTGAGAGTGAGAACACTTGGAGAGATTTAATGAAGACAGCTTTAGAAAACCTAATT
GTACTTTTGAAGGATGAAAACACAATTTCACCATATGAAATGTGTAGCAGTGGCTTGGTA
CAAGCACTTCTTACTGTGTTAAACAAT
gtaagtttatcaagtagtaaagaacaaaaatacagttttaaaaattatttgtagttactc
cttcggtagagtggtttttagtttgttttgtcaagaaatatttaaaagctgaatgatgtt
aatatttctaatttcttcagcctttaggttttatgattagtttgagccaaatgaattaaa

 1.19 Intr +  66566  66660   95  1  2   73   93    74 0.999   4.24
gcctactagtcacatactaaaaataattttaattgaaacatgaaatgatgaatgatttta
ttcacattgtagtgatcattgtataacaatatgttaacatttgtctcttagtttttgatg
aatttcagtaagatccttaaattatttttttttggactttatactttttgttttctttag
AGCATGGATTTGGATATGAAACAAGATTGTAGTCAACTGGTAGAAAGAATAAATGTTTTT
AAAACTGCCTTTAGTGAAAATGAAGATGATGAAAG
gtaaaatctcaaatttctttgaatttgatgtttgtaatgttcacacagttggtatacttc
ctctaaaataagtctagtgtaacatttatgcacacaaaagaaactcttaataagaaagta
acatattatacatgtataataagaggaaaatttttgaagttttttttaatctaatggaat

 1.20 Intr +  68521  68626  106  1  1   68   91   105 0.995   8.10
attcttaagtaaaggaaattgagttgtgagagtatttctactcagacataatctaataca
aaaattaaactgtagtcatgaaaaagtaggggtatatattgaagttgattaccatatttt
ctgcatgaacatttacatgtagttatacaaaacctcttaataataattatttcttcgcag
TCGACCAGCAGTTGCGTTAATTCGAAAGTTAATAGCTGTACTAGAATCTATTGAACGTCT
ACCTCTCCATTTGTATGATACACCAGGATCCACATATAACCTCCAG
gtaaccataaaaaatgtagtagctagtattgctgaatgcatctaggaacagtgtgacact
tttctttaaaaaaaattattttctttcacatcggattaaaataaaaatgattctacttaa
tctttaaagattttagcttatatgccatttgattgatcttaatgacttgaagtctgtttt

 1.21 Intr +  71853  71987  135  2  0   14  101   114 0.967   5.14
cgtctcagaaaaaaagaaaaaaaaaaagaatctttgatagaaaacagacatttgttcata
gttctattatgtttatagttaataaatccaaatctcagttgttttagggtatatcatttt
ttacaattctgagacagaaaccaagacgttttccagagtattttgatcgtttttgtgtag
ATACTTACAAGGAGATTACGATTTCGGTTGGAACGTGCACCTGGTGAAACTGCATTGATT
GACAGGACTGGCAGAATGTTGAAGATGGAACCTTTGGCTACAGTTGAATCTCTGGAACAG
TACCTTTTGAAAATG
gtgagtttctggcaagggcacggtgaaataagcattctgagctgtggtttagccttttag
gacaataatttgggaagtatatatccagagttatggtaatacagtttggcccagtaattc
cattttagaactgatttctacatgaagatgtttattataattttgtaatattgaaatagt

 1.22 Intr +  72903  73042  140  2  2   80  106   129 0.999  12.24
cacccacctccgcctcccaaagtgctgggattacaggcgtgaaccaccgcacccggccta
aatgagcatttgttataataaaagaaaacaattcacattaaagagataggaaaaaagtag
gtaacgtgcttgaaaacagcattattaaggtgactgtctttcatattttctttggtttag
GTAGCAAAACAGTGGTATGATTTTGACCGATCTTCATTTGTTTTTGTTCGAAAATTAAGA
GAAGGACAAAATTTTATATTTCGGCACCAGCATGATTTTGATGAAAATGGAATCATTTAC
TGGATTGGAACAAATGCAAA
gtaagtcagtcattttactttaagctggagtgaccatattcacttggtaaaagaattcta
ggaagtagaataaaattgttagcactctgaatattctgtggtttaaggaattttgacttg
taggtagaagttaagattatccaaattactttttatgaggaaaaaatgtctaaattgcta

 1.23 Intr +  73323  73646  324  0  0   70   44   237 0.534  11.46
gtttaaggaattttgacttgtaggtagaagttaagattatccaaattactttttatgagg
aaaaaatgtctaaattgctaattctagaattgtacttaatataattctgtatttaaaacc
ttgtgcaaatgcaattatcttaacgttgttatttgctaatttttctttatttttgtatag
AACTGCTTATGAATGGGTAAATCCAGCTGCCTATGGACTTGTAGTAGTAACGTCATCAGA
AGGAAGAAATCTACCTTATGGCCGCTTAGAAGACATACTAAGTCGTGATAATTCAGCTTT
AAATTGTCATAGCAATGATGATAAGAATGCCTGGTTTGCCATAGATCTGGGTCTCTGGGT
GATACCATCAGCATATACACTTCGTCATGCTCGTGGTTATGGAAGGTCTGCACTGAGAAA
TTGGGTTTTCCAGGTATCCAAAGATGGACAGAACTGGACTTCTTTGTATACCCATGTTGA
TGACTGCAGTCTCAATGAACCAGG
gttagttgaggagtctttgcaaattggaaaactcactaaagagctttgtttatttttata
attttatactctagagctctcttccttgtgaaatattgaagcaaaattttctttctaaaa
acaaatcacttgatactttaggcattaaaactttgaaacactgactttactaaaactttg

 1.24 Intr +  74843  75009  167  2  2   65   71   116 0.973   6.28
ttgttctcttgactactttttttcctttgatttcttgattcttgtaatgaactgttgagt
taatatgaaagttagtttattttttctacaggtctctgttatataaaaaatctttcccat
cttgaatttctttttcatcttttaaaatattacataattttttctctaacatattaacag
GTCAACTGCAACTTGGCCTCTTGATCCACCAAAGGATGAGAAACAAGGGTGGAGACATGT
GAGAATTAAACAGATGGGGAAAAATGCCAGTGGACAAACACACTACCTCTCATTATCTGG
ATTCGAACTTTATGGCACTGTAAATGGAGTATGTGAAGATCAGCTAG
gtaaagagatgatacgaggcttttctaacttactaaaacaattacttttgtaaaaagtga
tttggtttttatttctccaatttctacctgacagggaaagcagctaaagaagcagaagct
aatcttagacggcagagacgtctagtacgttcccaggttctgaaatacatggttccagga

 1.25 Intr +  75104  75280  177  0  0   65  101   197 0.999  17.67
aaatgccagtggacaaacacactacctctcattatctggattcgaactttatggcactgt
aaatggagtatgtgaagatcagctaggtaaagagatgatacgaggcttttctaacttact
aaaacaattacttttgtaaaaagtgatttggtttttatttctccaatttctacctgacag
GGAAAGCAGCTAAAGAAGCAGAAGCTAATCTTAGACGGCAGAGACGTCTAGTACGTTCCC
AGGTTCTGAAATACATGGTTCCAGGAGCTCGTGTTATCAGAGGCCTGGATTGGAAATGGC
GAGATCAGGATGGCAGCCCACAGGGAGAAGGCACTGTCACAGGAGAACTACACAATG
gtgagtaggtgctcagcacttttgtgtagaaaatgggtagttaaattttttcttttaaga
taatttataaattgcataaatgtatgagcactgtttagaagaactgttgataccacatta
caaatggaaaaaaggtaaagaaaataagggaaaattttaagttcttgggttttgactaga

 1.26 Intr +  79070  79906  837  0  0  108  108   774 0.999  71.83
atatcgtcaaataattgagtccaaaaatttacatatattttagtgggcagaccttgattg
actatagaaattcagaaaaggacagcactgatgaaaagctgatcccatattgtggagcta
ctgtctgacacgctcctatctgctttctgctgggtctcacaaactcctgtccctttccag
GCTGGATTGATGTCACCTGGGATGCTGGTGGCTCAAACTCTTACCGTATGGGCGCAGAAG
GAAAATTTGACCTCAAGCTTGCACCAGGGTACGACCCTGATACAGTGGCATCACCCAAAC
CTGTTTCATCCACTGTTTCAGGCACAACGCAATCATGGAGCAGCTTGGTGAAAAACAACT
GTCCAGACAAGACATCTGCTGCTGCAGGCTCCTCAAGTAGAAAAGGAAGCAGCAGTTCTG
TGTGTAGCGTGGCCAGTAGCAGCGACATCAGCTTGGGTTCGACCAAAACGGAACGGAGAT
CAGAAATTGTAATGGAACACAGTATAGTTTCAGGAGCTGATGTCCATGAACCAATTGTTG
TTCTTTCATCTGCTGAAAACGTCCCTCAAACAGAAGTAGGGTCATCTTCCAGTGCAAGCA
CCAGCACCTTAACAGCGGAAACGGGAAGTGAAAATGCTGAAAGGAAGTTAGGCCCTGATA
GTTCTGTTCGTACTCCTGGGGAGTCTAGTGCAATATCCATGGGAATTGTCAGTGTTAGTT
CTCCTGATGTTAGTTCAGTATCTGAATTAACTAATAAAGAAGCAGCTTCACAACGACCTC
TTAGCTCTTCAGCAAGTAACAGACTGTCAGTGAGTTCTTTGTTGGCTGCTGGGGCCCCTA
TGAGCTCTAGTGCAAGTGTACCTAACCTGTCCTCAAGAGAAACATCTAGCTTGGAGAGTT
TTGTAAGGAGAGTGGCAAACATAGCACGGACTAATGCCACGAACAACATGAATCTAAGCC
GAAGCAGCAGTGATAACAACACTAATACTTTGGGGAGGAATGTGATGAGCACAGCAA
gtaagtgagcttttccttctggaatccgatgctttttccacttggagggatgcaaaatag
ggtctcttgttctggctgcagtttttaactagatcattaaccatgttagataaagctaca
tcaaatttagcagttcaggaatatgaagttctctagaatcataatatttgcagaattcag

 1.27 Intr +  80512  80733  222  2  0   94  115   126 0.896  13.08
tgctataaaaagaatttttagttggatttcagttgggttcccaaagttgttgcttttcag
gaaccattttattattagtgtgttttatgacctcactctttaaaaaataaaaaacttggt
ttttctgaggtttctacaatctcacctatttgtactgatttgcttcatttttgtctttag
CTTCTCCTCTTATGGGTGCTCAGAGTTTCCCTAATTTGACCACACCTGGTACTACATCAA
CAGTGACTATGTCAACATCCAGTGTTACTAGCAGCAGCAATGTAGCTACAGCAACAACAG
TTTTATCAGTTGGTCAATCTTTAAGTAACACTTTAACCACCAGCCTCACATCAACTTCCA
GTGAGAGTGACACAGGTCAGGAAGCAGAATATTCCTTATATG
gtaagttgtaatttaaaatgaaagtatttagatactttcataatgatgcttttattatgt
tttctcctgatattttaaacttttgtttaaagagaattattctctcttcttataaatatg
aaatcttcgggccaggcacagtagctcacacctgtaatcccagcactttgggaggccgag

 1.28 Intr +  85471  85604  134  2  2   58   35   284 0.860  19.54
ttgtcctttatcacttgtttttgtcatgcttgtgtctgtgctcatcttgtatgtggtggc
agaacgcaacagttgtcccttttgaattttacttttgttttgtaaaaacctaaaatgcaa
agttcctttgttatgctttcttaattgtgttgacataaggttgtgggttttgttttcaag
ATTTCCTTGATAGCTGCCGTGCCAGTACTCTATTGGCTGAGCTCGATGATGATGAGGACT
TACCTGAGCCAGATGAAGAAGATGATGAGAATGAAGATGACAATCAGGAGGACCAAGAAT
ACGAGGAGGTTATG
gtagagagagtaccccattctctttacaaagataggatgttaataattgaaatgaagaaa
ggaaaagctaagtcataatcaaactttgaagcaaggaaatgtggcaccagtataaaaaat
gtagttaattaagaaaagcagttttaatctgagcatttatgattctccacttaaagaaaa

 1.29 Intr +  87013  87135  123  0  0   48   90   129 0.948   8.96
agtataaaatgcatgatgaatttaaaacattgaactcataacttttctgaagttggctaa
tgaaaaagttttcagtgacacttttgttaataggggttaatatattcaggtcatggctga
aagggggcatatatgggtcaaataattagacatgtatctcttgggattgttttattttag
ATTCTGAGACGCCCATCCCTGCAACGTCGAGCTGGCTCCCGCTCTGATGTAACGCATCAT
GCTGTTACCTCGCAGCTACCACAGGTACCTGCTGGAGCAGGGAGCCGACCTATTGGGGAG
CAG
gtaatatcttcatgtttatcttccctaccatatgtatatttttcccttttatagtaaagc
accaacctaaatgcctacaaaaatgtgcagtgtggaaggggtgagaggagggagctacca
aacagttacacaaagaaacttcccctactggttgggtttcatattctatatagaatccat

 1.30 Intr +  88652  88808  157  1  1   54   92   227 0.999  18.36
cttactttgggtaaactgaaatgatgaagaaatgtatgtatctatacatgtttaggttag
ctcattttgggtttaagaaatatggctaaggaaatgcagtagttctaaataacacattgc
ttttgcaacaatgaaattttgcatcttattatgtttgtgtgtgaaattttattttgatag
GAAGAAGAAGAGTACGAAACTAAAGGAGGACGCCGGAGAACATGGGATGATGATTATGTG
CTAAAGAGACAGTTTTCTGCATTGGTTCCTGCTTTTGATCCTAGACCTGGTCGTACTAAT
GTCCAGCAGACAACTGATCTAGAAATACCACCCCCAG
gtacagaatgttttggttttgtgatttaattttaatacatactaaatcagatatgaaaag
tagggtgttgcttttgtatgcacgttattaaaaatttttttttagttttgtgtatgcagg
ttataaaaaatttttttagtcagccacaaattctttaaaaagtaaaggtttttttaaagg

 1.31 Intr +  92060  92282  223  0  1   82   76   106 0.661   5.06
aaaaaaagaaacagaaagcaaaaatgtcgacgcctagagagtcttaagtagctgacatcc
tttagctaatatatggcagagaggtttggatttcatgtagccttgtttcctagtgtagtg
gcctttcttggactgcttgttttagtataattgtttttcacccatcttccaaatttttag
GGACCCCTCATTCAGAGCTCTTGGAAGAAGTCGAATGTACTCCGTCACCTCGATTAGCTC
TCACTTTGAAAGTAACAGGTCTTGGAACGACTCGTGAAGTTGAATTACCACTCACCAATT
TCAGATCAACCATCTTTTACTATGTACAAAAATTGCTTCAATTGTCCTGTAATGGCAATG
TGAAATCAGATAAACTTAGGCGTATTTGGGAGCCCACATACAC
gtaagaaattttaacttaatgttttggtagataatgtcctagtgtagagccaagaagcat
tgcatttattttggattataggaacagaaaagattttgtttttattctgttggcttacag
gaacagataatagtgtttgggactcttggtgtagaatgattaagttttagaagtagaagg

 1.32 Intr +  94178  94232   55  2  1   57  115    58 0.663   3.46
caacatagcaaaaccttatctctacaaaaaatatagaaaaaaagaatcctccttgagttc
agtgttcagtgcaggcatatgtctagtgaatgacattcacttttttttttaaagaattga
agccttattggaaataatcacaaattatatatgaattaacttgaatatcttcatgtttag
AATCATGTACAGAGAAATGAAGGATTCTGATAAAGAAAAGGAAAATGGAAAAATG
gtaagttattttagaacattggtttactcttggctatttagttaaaagaagaaagatagt
aaaactaacacagtattgcagttgaacgttgaagggaataatgactaacatggaattctt
tagattagaccaagtgcatgatcttaaagctacctcatgtaatgcatgtgaaatatcata

 1.33 Intr +  94459  94641  183  0  0   73   71   148 0.999  10.66
agaagaaagatagtaaaactaacacagtattgcagttgaacgttgaagggaataatgact
aacatggaattctttagattagaccaagtgcatgatcttaaagctacctcatgtaatgca
tgtgaaatatcatagactttataattgggaaaggccaacatttggtttttcctgttgtag
GGTTGCTGGTCTATAGAGCATGTGGAGCAGTACCTTGGCACTGATGAATTACCAAAGAAT
GACTTGATAACCTACCTGCAGAAGAATGCAGACGCTGCTTTCCTGCGCCACTGGAAATTA
ACTGGCACTAATAAAAGTATTAGGAAAAACAGAAATTGTTCTCAGCTCATAGCTGCATAT
AAG
gtatatattggcatcaaaacactattttgattgcaaatggcttcgtgctttgttttgcag
ctttggaagcttcttaaggaacagcagttcattgagacataattttaaaaatgaggttga
attaacactgttaatgcacaaattctaaaatttcaaatatggctggtagcattggatctg

 1.34 Intr +  95034  95241  208  2  1   74   66    95 0.682   3.63
atattttatttgggaattttaatggtttagaatgccttgatttatgtcttgtgttatgtt
tttatttaaaaagaaggcactttaaaaaattccaaccctttcatagtggtattgatacaa
tgatacactgtttttcttgaaaatgtgattaatggccagtttttctaattgtttctatag
GATTTTTGTGAGCATGGAACAAAGTCTGGGTTAAACCAGGGGGCCATTTCTACTCTTCAA
AGTAGTGATATTCTTAATTTAACAAAAGAACAACCTCAGGCCAAAGCAGGCAATGGACAG
AACTCTTGTGGAGTAGAAGATGTCCTTCAGCTTCTGCGTATTCTATATATAGTTGCAAGT
GACCCTTATTCAAGAATATCCCAGGAAG
gtctgtaagaagccttgtttcatttctatagcagttttaaagcaagtcagtttatatttt
tattaattttattaattaattttatagatggtgatgaacagcttcagtttacttttccac
cagatgaattcactagcaaaaaaattacaacaaaaatattacagcagattgaggtaataa

 1.35 Intr +  95329  95414   86  2  2   57   75    39 0.668  -1.88
gacagaactcttgtggagtagaagatgtccttcagcttctgcgtattctatatatagttg
caagtgacccttattcaagaatatcccaggaaggtctgtaagaagccttgtttcatttct
atagcagttttaaagcaagtcagtttatatttttattaattttattaattaattttatag
ATGGTGATGAACAGCTTCAGTTTACTTTTCCACCAGATGAATTCACTAGCAAAAAAATTA
CAACAAAAATATTACAGCAGATTGAG
gtaataaaatcagacagctgaactcttcattctattactgttggacttttcctaatattc
cctttactttcttttctacctctcaccatctttcccttccctctgattggtaatttgagc
tatatggtcctttgcatttatttcctaattacaggtttataattgacttggtaattttta

 1.36 Intr +  95975  96102  128  1  2   78  116    25 0.886   2.86
gcaggagaatcgcttgaacccaggaggcagaggctgcagtgagccgagatcgtaccactg
cacaccagcctgggcaacagagtgagactctgtctcaaaaaaaaaaatgaacgaatgaat
gaatgcatgcatgcatgaatgccttatagcactaagacattattatttgttaattcgcag
GAACCATTGGCACTGGCAAGTGGGGCTCTGCCAGACTGGTGTGAACAATTAACCAGCAAA
TGTCCTTTTCTAATACCATTTGAAACTAGACAGCTTTATTTCACATGTACAGCATTTGGC
GCCTCAAG
gtaagaagccttttttttatgtttttagaataagtatgcttttatgttatgtaagttgaa
aatgtacaactatactgtcaagactgatagagggaatatattatcttgtattcttataaa
gaatagtcagcattgccttttggcctgaactaccaatcttctagtaattcgccaaaatga

 1.37 Intr +  98920  99121  202  1  1   76   74   259 0.999  21.67
catatatttttacttgtgacaggaagcagtttatgtaacaaaaaaagattactgtgtttt
aaaaatcacctgataaaatactattttttaatttcttaaatctttgaattctgttgctgg
tttagtagtacattcagctgttaacgtatgctgcagctcatagatatttttctatttcag
AGCAATAGTATGGTTACAGAACCGACGTGAAGCCACTGTGGAGCGAACGAGAACCACAAG
CAGTGTTAGGCGAGATGACCCTGGAGAGTTTCGAGTTGGTCGTCTCAAGCATGAAAGAGT
AAAAGTTCCACGTGGCGAGTCACTGATGGAATGGGCTGAGAATGTCATGCAAATACATGC
AGATCGGAAATCAGTTCTTGAG
gtaatctcatataaaattagatttagggaacaggaatgacacttagggaaccagcccaat
gtgtatcttcactgcattaaaaactgtggtaggtaaacatgaagaggggttttcctgttc
tgtaggcagaagccttctcctctggcagagcatctttttcataagaggatgtcagtccac

 1.38 Intr + 100814 100951  138  1  0   78   76   134 0.996  10.94
gtggactctttaggaaaattaaaataacacttctgtgctgtttattatatatatacactg
ctattttgaaaaaaggtacattactggatcagatatgataaattttgacaagaattagat
tatttttaaaaacaccccaaactttacgtttaacccacaatttatttgttcatattttag
GTTGAATTTTTAGGAGAAGAAGGAACTGGCTTGGGACCCACATTAGAGTTTTATGCTCTG
GTGGCAGCAGAATTCCAGAGAACTGACTTGGGAGCTTGGCTTTGTGATGATAATTTTCCA
GATGATGAATCTCGTCAC
gtaagaatatttctcattttgtgacttgagttgtgactctgctttcaaaagtgttaaaaa
taggttatgtgttcagagcataagccaggtttctgactctacttttattattgaataatc
ttgatgcaattaaaatagttctaaagcgataaaatttagtcaccaaaagctatttaataa

 1.39 Intr + 101265 101872  608  2  2   24   98   218 0.655   6.72
aatagttctaaagcgataaaatttagtcaccaaaagctatttaataaaattatatacttt
tagatagccaaattcatgaagatgtttaatgtttatggatttttttcttagatgatgata
ggcttagtttctattaacttttgtttaattttatttgcatttcaccctctaaaaaattag
GTTGATCTTGGAGGTGGATTGAAACCTCCTGGATATTATGTGCAGAGGTCATGTGGACTG
TTCACAGCACCATTTCCACAGGATAGTGATGAGCTTGAAAGGATCACGAAACTGTTTCAT
TTCCTTGGAATTTTCTTGGCCAAATGCATTCAAGACAATAGACTTGTGGACTTACCTATT
TCTAAACCTTTTTTTAAACTTATGTGTATGGGTGACATTAAAAGCAATATGAGTAAACTG
ATTTATGAGTCACGAGGTGATAGAGACTTACACTGTACTGAAAGTCAGTCTGAAGCTTCT
ACAGAAGAAGGTCATGATTCACTCTCGGTAGGAAGCTTTGAAGAGGATTCAAAATCAGAA
TTTATTCTTGATCCCCCTAAACCAAAACCCCCAGCTTGGTTTAATGGAATTTTGACTTGG
GAAGACTTTGAATTAGTAAACCCACACAGAGCCAGATTTTTAAAAGAAATTAAAGACCTT
GCTATCAAGAGGCGCCAAATTTTAAGCAACAAAGGTCTTTCTGAAGATGAGAAGAACACA
AAATTACAGGAACTAGTGCTGAAGAATCCATCAGGTTCTGGGCCTCCACTTAGCATAGAG
GATTTAGG
gtaagcattatatgtacattcttcaatccaatgcatgaataagttttaaagcttttgttt
ctttgtcgtcactgatttgcaatatatgagtaaatagtctgtcaaaaacagtaatatgct
gtaggaaatattgatgatcgacttgaacctttgatttaatattataaagacaacactcag

 1.40 Intr + 102850 102928   79  1  1  103   83    58 0.911   5.43
ctggtgtactgattttgttggaggaggagaggggtgggatttatggttttgatagccatg
ttattttatttaattttttctcttgtacccactgatggcagatgatagtaatgttataaa
aattaaacaccattagtagtagctgcatgtcagttaatttaatcttttttgtcctcccag
TTTAAATTTCCAGTTTTGCCCTTCCTCAAGAATATATGGTTTTACAGCTGTGGATCTCAA
GCCAAGTGGTGAAGATGAG
gtaaaaagtttgcttttaatatagttgtaagttctgacatatcctcttagcaaggccagt
tgtactagacactcctgaaatattcctagatactgacaaattttcttttgcagatgataa
caatggataatgcagaagaatatgtggatttgatgtttgacttttgtatgcatacgggta

 1.41 Intr + 103042 103135   94  0  1   69   76   117 0.965   7.22
gttttgcccttcctcaagaatatatggttttacagctgtggatctcaagccaagtggtga
agatgaggtaaaaagtttgcttttaatatagttgtaagttctgacatatcctcttagcaa
ggccagttgtactagacactcctgaaatattcctagatactgacaaattttcttttgcag
ATGATAACAATGGATAATGCAGAAGAATATGTGGATTTGATGTTTGACTTTTGTATGCAT
ACGGGTATTCAGAAACAAATGGAAGCCTTTAGAG
gtaattttaaaggatttttagcataattgctctcctttcactttgagacagttgaaatta
tggtcaagaattgctggtggtcggctgggcacggtggctcacacctgtaatcccagcact
ttgggaggctgaggcgggaggatcacctgaggttgggagttcgagaccagcctgaccaac

 1.42 Intr + 105452 105602  151  0  1   21   91    96 0.947   1.50
gttgcatagtattccattgtgtacatataccacattttctttacacattcatcccttgat
agatacttagattgattctgataatgggtattttggtttgaaatttggtattttggaatc
gtaacttggaaactgagttgtatgtttgttttttgtgtttccgttacatgtacgatgtag
ATGGGTTTAATAAAGTTTTTCCAATGGAGAAATTAAGTTCCTTCAGCCATGAAGAAGTCC
AAATGATTCTTTGTGGAAACCAGTCACCATCCTGGGCAGCAGAGGATATTATCAATTACA
CTGAACCTAAGCTGGGTTATACACGTGACAG
gtatgtgatactattttccaagatcaacaaaattatttatattccccaaatcaaatgaca
gattctctaaagaactttaattcagtgagtatcataaagtaagtgagaaagcagtggtgt
ctcacagttaccagaatgcatatccactgataaggctgggaggatacaaaaagacaactg

 1.43 Intr + 107194 107338  145  1  1   97   82    40 0.980   3.66
atttttaaagtagcttatattagcccatttcatacttaaccaagagtctctagatgtgtt
gttgttctggtgtgaggatattgttttttagggggcttgttgctgccttagaaaatagtg
gtagtgattttcatttaaatctgcagtcaactcaatataactatatttttgttcttttag
CCCTGGTTTCCTGAGGTTTGTGAGGGTTTTATGTGGCATGTCTTCTGATGAAAGGAAAGC
ATTCTTGCAGTTTACCACTGGTTGTTCAACTCTACCCCCAGGTGGACTGGCTAACCTGCA
TCCCAGGCTCACGGTTGTACGCAAG
gtacaagctctctggctaatggggaatccaaatgaaatttagttactttacttttgaaag
aaagaagtatttaaactcatggtcttctgttgtgtttgctttcttgttgtaggttgatgc
tactgatgcaagctatccatcagtcaatacatgtgtgcattaccttaagttgcctgaata

 1.44 Term + 107451 107588  138  2  0   93   49   101 0.995   3.68
ctggttgttcaactctacccccaggtggactggctaacctgcatcccaggctcacggttg
tacgcaaggtacaagctctctggctaatggggaatccaaatgaaatttagttactttact
tttgaaagaaagaagtatttaaactcatggtcttctgttgtgtttgctttcttgttgtag
GTTGATGCTACTGATGCAAGCTATCCATCAGTCAATACATGTGTGCATTACCTTAAGTTG
CCTGAATATTCTTCCGAGGAGATCATGAGAGAGCGCCTGCTAGCTGCTACAATGGAGAAA
GGCTTTCATCTCAATTGA
gctttgaagtgcaatgggagacatcagagactttaaaaatactagtgaagcctcttgtgt
ttgtgtgcagagaagtatatgatccaccatgctaatgacacttgcctttttttccaccat
taaggctttaagaacatgtggaataagttttttagctgctaatgacaaaacaaatcctgt

Predicted peptide sequence(s):


>HECTD1_1|GENSCAN_predicted_peptide_1|2737_aa
GSEKGARAHHRKAAAETYDTARGGGGESSGAGTATRRTRFGAPARRSAVPQRPSTARASE
LQGLRSRVLGTGRPLAAAARENLSLPCHQVLAEEGEGRGAAFPVPPARFDLRGLRLLGNS
RAAAGPGSAGGLLGAGSERFGTTSPNVDPDTLLEWLQMGQGDERDMQLIALEQLCMLLLM
SDNVDRCFETCPPRTFLPALCKIFLDESAPDNVLEVTARAITYYLDVSAECTRRIVGVDG
AIKALCNRLVVVELNNRTSRDLAEQCVKVLELICTRESGAVFEAGGLNCVLTFIRDSGHL
VHKDTLHSAMAVVSRLCGKMEPQDSSLEICVESLSSLLKHEDHQVSDGALRCFASLADRF
TRRGVDPAPLAKHGLTEELLSRMAAAGGTVSGPSSACKPGRSTTGAPSTTADSKLSNQVS
TIDLLRSELPDSIESALQGDERCVLDTMRLVDLLLVLLFEGRKALPKSSAGSTGRIPGLR
RLDSSGERSHRQLIDCIRSKDTDALIDAIDTGAFEVNFMDDVGQTLLNWASAFGTQEMVE
FLCERGADVNRGQRSSSLHYAACFGRPQVAKTLLRHGANPDLRDEDGKTPLDKARERGHS
EVVAILQSPGDWMCPVNKGDDKKKKDTNKDEEECNEPKGDPEMAPIYLKRLLPVFAQTFQ
QTMLPSIRKASLALIRKMIHFCSEALLKEVCDSDVGHNLPTILVEITATVLDQEDDDDGH
LLALQIIRDLVDKGGDIFLDQLARLGVISKVSTLAGPSSDDENEEESKPEKEDEPQEDAK
ELQQGKPYHWRDWSIIRGRDCLYIWSDAAALELSNGSNGWFRFILDGKLATMYSSGSPEG
GSDSSESRSEFLEKLQRARGQVKPSTSSQPILSAPGPTKLTVGNWSLTCLKEGEIAIHNS
DGQQATILKEDLPGFVFESNRGTKHSFTAETSLGSEFVTGWTGKRGRKLKSKLEKTKQKV
RTMARDLYDDHFKAVESMPRGVVVTLRNIATQLESSWELHTNRQCIESENTWRDLMKTAL
ENLIVLLKDENTISPYEMCSSGLVQALLTVLNNSMDLDMKQDCSQLVERINVFKTAFSEN
EDDESRPAVALIRKLIAVLESIERLPLHLYDTPGSTYNLQILTRRLRFRLERAPGETALI
DRTGRMLKMEPLATVESLEQYLLKMVAKQWYDFDRSSFVFVRKLREGQNFIFRHQHDFDE
NGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLEDILSRDNSALNCHSNDDK
NAWFAIDLGLWVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPG
STATWPLDPPKDEKQGWRHVRIKQMGKNASGQTHYLSLSGFELYGTVNGVCEDQLGKAAK
EAEANLRRQRRLVRSQVLKYMVPGARVIRGLDWKWRDQDGSPQGEGTVTGELHNGWIDVT
WDAGGSNSYRMGAEGKFDLKLAPGYDPDTVASPKPVSSTVSGTTQSWSSLVKNNCPDKTS
AAAGSSSRKGSSSSVCSVASSSDISLGSTKTERRSEIVMEHSIVSGADVHEPIVVLSSAE
NVPQTEVGSSSSASTSTLTAETGSENAERKLGPDSSVRTPGESSAISMGIVSVSSPDVSS
VSELTNKEAASQRPLSSSASNRLSVSSLLAAGAPMSSSASVPNLSSRETSSLESFVRRVA
NIARTNATNNMNLSRSSSDNNTNTLGRNVMSTATSPLMGAQSFPNLTTPGTTSTVTMSTS
SVTSSSNVATATTVLSVGQSLSNTLTTSLTSTSSESDTGQEAEYSLYDFLDSCRASTLLA
ELDDDEDLPEPDEEDDENEDDNQEDQEYEEVMILRRPSLQRRAGSRSDVTHHAVTSQLPQ
VPAGAGSRPIGEQEEEEYETKGGRRRTWDDDYVLKRQFSALVPAFDPRPGRTNVQQTTDL
EIPPPGTPHSELLEEVECTPSPRLALTLKVTGLGTTREVELPLTNFRSTIFYYVQKLLQL
SCNGNVKSDKLRRIWEPTYTIMYREMKDSDKEKENGKMGCWSIEHVEQYLGTDELPKNDL
ITYLQKNADAAFLRHWKLTGTNKSIRKNRNCSQLIAAYKDFCEHGTKSGLNQGAISTLQS
SDILNLTKEQPQAKAGNGQNSCGVEDVLQLLRILYIVASDPYSRISQEDGDEQLQFTFPP
DEFTSKKITTKILQQIEEPLALASGALPDWCEQLTSKCPFLIPFETRQLYFTCTAFGASR
AIVWLQNRREATVERTRTTSSVRRDDPGEFRVGRLKHERVKVPRGESLMEWAENVMQIHA
DRKSVLEVEFLGEEGTGLGPTLEFYALVAAEFQRTDLGAWLCDDNFPDDESRHVDLGGGL
KPPGYYVQRSCGLFTAPFPQDSDELERITKLFHFLGIFLAKCIQDNRLVDLPISKPFFKL
MCMGDIKSNMSKLIYESRGDRDLHCTESQSEASTEEGHDSLSVGSFEEDSKSEFILDPPK
PKPPAWFNGILTWEDFELVNPHRARFLKEIKDLAIKRRQILSNKGLSEDEKNTKLQELVL
KNPSGSGPPLSIEDLGLNFQFCPSSRIYGFTAVDLKPSGEDEMITMDNAEEYVDLMFDFC
MHTGIQKQMEAFRDGFNKVFPMEKLSSFSHEEVQMILCGNQSPSWAAEDIINYTEPKLGY
TRDSPGFLRFVRVLCGMSSDERKAFLQFTTGCSTLPPGGLANLHPRLTVVRKVDATDASY
PSVNTCVHYLKLPEYSSEEIMRERLLAATMEKGFHLN