GENSCAN 1.0	Date run: 15-Jan-104	Time: 07:36:23

Sequence GPX2_1 : 6059 bp : 48.14% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1288   1347   60  0  0   95   71    86 0.993   8.85
ccttgttcaaacagcacttacaggtggggacctgtttttgctaagtcatcctggggatgc
tcaaagctccattgttagatcctttctgtcctccttcctggctcctccttcctccccacc
cctctaataggctcataagtgggctcaggcctctctgcggggctcactctgcgcttcacc
ATGGCTTTCATTGCCAAGTCCTTCTATGACCTCAGTGCCATCAGCCTGGATGGGGAGAAG

gtagatttcaatacgttccggggcagggccgtgctgattgagaatgtggcttcgctctga
ggcacaaccacccgggacttcacccagctcaacgagctgcaatgccgctttcccaggcgc
ctggtggtccttggcttcccttgcaaccaatttggacatcaggtgaggggtccctccttg

 1.02 Term +   4176   4526  351  2  0  114   37   507 0.999  42.69
cttgagcccagaagttcaaggctgcagtgagcaacacctcgtctgtcttgtctctctctc
tttcacagtgaaaaagaatgaccctggggagggagtgtaggagggtgaaagagtttcatg
ttgtggatctttctcttcccccacccactgtccacgcactttgtctttttcctcccctag
GAGAACTGTCAGAATGAGGAGATCCTGAACAGTCTCAAGTATGTCCGTCCTGGGGGTGGA
TACCAGCCCACCTTCACCCTTGTCCAAAAATGTGAGGTGAATGGGCAGAACGAGCATCCT
GTCTTCGCCTACCTGAAGGACAAGCTCCCCTACCCTTATGATGACCCATTTTCCCTCATG
ACCGATCCCAAGCTCATCATTTGGAGCCCTGTGCGCCGCTCAGATGTGGCCTGGAACTTT
GAGAAGTTCCTCATAGGGCCGGAGGGAGAGCCCTTCCGACGCTACAGCCGCACCTTCCCA
ACCATCAACATTGAGCCTGACATCAAGCGCCTCCTTAAAGTTGCCATATAG
atgtgaactgctcaacacacagatctcctactccatccagtcctgaggagccttaggatg
cagcatgccttcaggagacactgctggacctcagcattcccttgatatcagtccccttca
ctgcagagccttgcctttcccctctgcctgtttccttttcctctcccaaccctctggttg

Predicted peptide sequence(s):


>GPX2_1|GENSCAN_predicted_peptide_1|136_aa
MAFIAKSFYDLSAISLDGEKENCQNEEILNSLKYVRPGGGYQPTFTLVQKCEVNGQNEHP
VFAYLKDKLPYPYDDPFSLMTDPKLIIWSPVRRSDVAWNFEKFLIGPEGEPFRRYSRTFP
TINIEPDIKRLLKVAI