GENSCAN 1.0	Date run: 15-Jan-104	Time: 07:58:21

Sequence FOS_1 : 5782 bp : 52.32% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1356   1496  141  2  0   98  110   184 0.963  21.70
cagtggctgcggcgcctcgtactccaaccgcatctgcagcgagcatctgagaagccaaga
ctgagccggcggccgcggcgcagcgaacgagcagtgaccgtgctcctacccagctctgct
ccacagcgcccacctgtctccgcccctcggcccctcgcccggctttgcctaaccgccacg
ATGATGTTCTCGGGCTTCAACGCAGACTACGAGGCGTCATCCTCCCGCTGCAGCAGCGCG
TCCCCGGCCGGGGATAGCCTCTCTTACTACCACTCACCCGCAGACTCCTTCTCCAGCATG
GGCTCGCCTGTCAACGCGCAG
gtaaggctggcttcccgtcgccgcggggccgggggcttggggtcgcggaggaggagacac
cgggcgggacgctccagtagatgagtagggggctcccttgtgcctggagggaggctgccg
tggccggagcggtgccggctcgggggctcgggacttgctctgagcgcacgcacgcttgcc

 1.02 Intr +   2250   2501  252  2  0  104   94   139 0.969  14.26
gctgcggaatgcctgggaggaaaagggggagacctttcatccaggatgagggacatttaa
gatgaaatgtccgtggcaggatcgtttctcttcactgctgcatgcggcactgggaactcg
ccccacctgtgtccggaacctgctcgctcacgtcggctttccccttctgttttgttctag
GACTTCTGCACGGACCTGGCCGTCTCCAGTGCCAACTTCATTCCCACGGTCACTGCCATC
TCGACCAGTCCGGACCTGCAGTGGCTGGTGCAGCCCGCCCTCGTCTCCTCCGTGGCCCCA
TCGCAGACCAGAGCCCCTCACCCTTTCGGAGTCCCCGCCCCCTCCGCTGGGGCTTACTCC
AGGGCTGGCGTTGTGAAGACCATGACAGGAGGCCGAGCGCAGAGCATTGGCAGGAGGGGC
AAGGTGGAACAG
gtgaggaactctagcgtactcttcctgggaatgtgggggctgggtgggaagcagccccgg
agatgcaggagcccagtacagaggatgaagccactgatggggctggctgcacatccgtaa
ctgggagccctggctccaagcccattccatcccaactcagactctgagtctcaccctaag

 1.03 Intr +   2933   3040  108  1  0   50   78   156 0.999  11.78
gctgaggatcttattttaaatgcaagtcacacctagtctgcaactgcaggtcagaaatgg
tttcacagtggggtgccaggaagcagggaagctgcaggagccagttctactggggtgggt
gaatggaggtgatggcagacacttttactgaatgtcggtctttttttgtgattattctag
TTATCTCCAGAAGAAGAAGAGAAAAGGAGAATCCGAAGGGAAAGGAATAAGATGGCTGCA
GCCAAATGCCGCAACCGGAGGAGGGAGCTGACTGATACACTCCAAGCG
gtaggtactctgtgggttgctcctttttaaaacttaaggggaaagttggagattgagcat
aagggcccttgagtaagactgtgtcttatgctttcctttatccctctgtatacaggagac
agaccaactagaagatgagaagtctgctttgcagaccgagattgccaacctgctgaagga

 1.04 Term +   3156   3797  642  2  0   87   55   814 0.999  72.59
ggaataagatggctgcagccaaatgccgcaaccggaggagggagctgactgatacactcc
aagcggtaggtactctgtgggttgctcctttttaaaacttaaggggaaagttggagattg
agcataagggcccttgagtaagactgtgtcttatgctttcctttatccctctgtatacag
GAGACAGACCAACTAGAAGATGAGAAGTCTGCTTTGCAGACCGAGATTGCCAACCTGCTG
AAGGAGAAGGAAAAACTAGAGTTCATCCTGGCAGCTCACCGACCTGCCTGCAAGATCCCT
GATGACCTGGGCTTCCCAGAAGAGATGTCTGTGGCTTCCCTTGATCTGACTGGGGGCCTG
CCAGAGGTTGCCACCCCGGAGTCTGAGGAGGCCTTCACCCTGCCTCTCCTCAATGACCCT
GAGCCCAAGCCCTCAGTGGAACCTGTCAAGAGCATCAGCAGCATGGAGCTGAAGACCGAG
CCCTTTGATGACTTCCTGTTCCCAGCATCATCCAGGCCCAGTGGCTCTGAGACAGCCCGC
TCCGTGCCAGACATGGACCTATCTGGGTCCTTCTATGCAGCAGACTGGGAGCCTCTGCAC
AGTGGCTCCCTGGGGATGGGGCCCATGGCCACAGAGCTGGAGCCCCTGTGCACTCCGGTG
GTCACCTGTACTCCCAGCTGCACTGCTTACACGTCTTCCTTCGTCTTCACCTACCCCGAG
GCTGACTCCTTCCCCAGCTGTGCAGCTGCCCACCGCAAGGGCAGCAGCAGCAATGAGCCT
TCCTCTGACTCGCTCAGCTCACCCACGCTGCTGGCCCTGTGA
gggggcagggaaggggaggcagccggcacccacaagtgccactgcccgagctggtgcatt
acagagaggagaaacacatcttccctagagggttcctgtagacctagggaggaccttatc
tgtgcgtgaaacacaccaggctgtgggcctcaaggacttgaaagcatccatgtgtggact

Predicted peptide sequence(s):


>FOS_1|GENSCAN_predicted_peptide_1|380_aa
MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANF
IPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKTMTGGRA
QSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQ
TEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEVATPESEEAFT
LPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYA
ADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSFVFTYPEADSFPSCAAAHRK
GSSSNEPSSDSLSSPTLLAL