GENSCAN 1.0	Date run: 15-Jan-104	Time: 08:13:11

Sequence CALM1_1 : 13421 bp : 46.43% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +    655    826  172  2  1   65   59   152 0.531   9.00
agaaatattcaggcatcctaaaaaatattcagtggaaacgtaaaaacattaaagactgat
taaacatcgcagcatgacacagatttagcaactgagcataaataatttgactcggatact
gctccaaaatccgaagaggaccaatttcttccaggaggacaactacctcgtcctctgcag
ACCCCTCTCCTCGGCAGCTGAAGGAGTGTGGCCAATCTGCCTCCACCTCCCCGCGGACCC
CCTACTCTCAGGACCTCCTGCAGCACCCCAAACTGGAAGTGGCCGCTGCAGACCCAAGGA
CGAGGGGCACGCGGGAGCCGGCAGCCCTAGTGGAGCGGTTGGAGATGTTGAG
gtgggagggtcacccaggtggggtgaggctggggtaggtagcggagtgaacggcttccga
agctctgggccgcccccaggttggactaagcaggcgctctgtcttcgcccccgcccaggg
tgggcgtctcctgaggactccccgccacacctgacccgagaccgcgcgcccagcctagaa

 1.02 Intr +   1202   1322  121  2  1   28   65    81 0.751   0.30
gcgtagggccgccgcgactggcgcgcagggggcggcgggaggcctggcgaacccgggggc
gggaccaggcgggcaaggcccggctgccgcagcgccgctctgcgcgaggcggctccgccg
cggcggagggatacggcgcaccatatatatatcgcggggcgcagactcgcgctccggcag
TGGTGCTGGGAGTGTCGTGGACGCCGTGCCGTTACTCGTAGTCAGGCGGCGGCGCAGGCG
GCGGCGGCGGCATAGCGCACAGCGCGCCTTAGCAGCAGCAGCAGCAGCAGCGGCATCGGA
G
gtacccccgccgtcgcagcccccgcgctggtgcagccaccctcgctccctctgctcttcc
tcccttcgctcgcaccatggtaggtcgggagtggcaaatgccggcgtagcagctgcccga
gatttcttcccagatttctagttgttttgtttgttttttgtttgtttttggttcttggag

 1.03 Intr +   2620   2757  138  0  0   85   46    42 0.412   0.36
ggtgcgcgggggccgggggtggtgaccctcctggccgaggaggggcggcgtccagacgcc
cgctcgggggccgccttcccccccacgcctgcccccgggcacgcgccctgcccggtccct
cgccccgcgccacttccagtccgcagagagatgccctccacgtttctgctttctctgcag
CCTCTAGATTGCCAGATGCGACTGTGCGCCTCGCTGGGTGTGTTTTCCACAGCCCCTTCC
TCCTCGGCGTGCAGGGCTGACATCACCGACTGCGTTTCTGGTTTGGCGGGTGGGGAGATG
GTTCCCCGCAGGGTTCTG
gtacacctttgcccccagggctagcgccatttgggggaggaggttttcgttgtcgagaaa
gttggatgctcctggtaacccctctaacaagagagttctgtagcgaggtgggactgttct
ccccataaggtgacagtttctcttgcgaggtgtggcagcgcttcctgttgtacaagacag

 1.04 Intr +   4233   4263   31  2  1  102  119    58 0.996   8.00
tagcataaggagttttctttattctatttactttcattaaatgaccgtgctacaggtttc
aaaggattttaagattgatttttgaaagatcacaatattaaaagtataactggaaaacct
atgttgaaatcaaccaaacatgtcgtggactgaatgataaccttttctttcttcatatag
GCTGATCAGCTGACCGAAGAACAGATTGCTG
gtaagttgacaactccaaggagtccccagaaggccagaactaggcactgactcagttttg
gtgactcctctgttcctccccgctacagtctgggcagttttctaagaatttatttaaata
agaacagtaagcagaaacactgaggtcagatgttattcttgccagtactttatagatgag

 1.05 Intr +   5427   5570  144  1  0   90   95   171 0.999  18.25
ggctgctgtatgaaggccagtccaacaggactattgtggtcattatttcagtagataaag
accagacttctgatacgttgcacaacttgaatggctggctttggcaagcccccggcaagt
gtgtattgtgactgggttggataaagacattgattctaacgggtcaacttttgttttcag
AATTCAAGGAAGCCTTCTCCCTATTTGATAAAGATGGCGATGGCACCATCACAACAAAGG
AACTTGGAACTGTCATGAGGTCACTGGGTCAGAACCCAACAGAAGCTGAATTGCAGGATA
TGATCAATGAAGTGGATGCTGATG
gtaagagctttaaaaccatgaatgagggccattgttgtgtaattcaagttcagacatgtt
acaggattgtctttcaggtccccagagcaaagcaaatgtgcaaagatcctttctgtggtt
gccccagggccattgacaattaaaatagaagatgatgggccttgcgtccatcctgcttag

 1.06 Intr +   8030   8136  107  0  2   35   84   129 0.965   7.13
aaattgccctgtgaagtgtttgaacgttttagacctgcagatgattgaacctagtaagat
agtctgcccctttgtcctagtacatgtttaccgttccgtacagtggttctgaaatgatta
ctgcagagcagcgttaatggagtgcttactttacatgagctttttgttttttaattcgag
GTAATGGCACCATTGACTTCCCCGAATTTTTGACTATGATGGCTAGAAAAATGAAAGATA
CAGATAGTGAAGAAGAAATCCGTGAGGCATTCCGAGTCTTTGACAAG
gtaatccagcatctacatagcagatggtacttaagtatggcttcttccgctttcacttct
aaaagctataataatgttatagacagaagacttaaatctaactgcctgagcctctgatct
cactttcaaaaatcctccttatggtaaccgtatcaggggagggtaggcataataaatagg

 1.07 Intr +   8547   8682  136  2  1   42   93   169 0.915  12.94
gcaaatcctgttttctgcattagctgtttgcatgtatttagtaggttagaggtgggaact
agagatcagagaattgtttatggcagcagagttagcagtaacttgagagggcatagctaa
gtcaaagacctacttccccacactacatcattagcaataacaattgctgaatgttcacag
GATGGCAATGGTTATATCAGTGCAGCAGAACTACGTCACGTCATGACAAACTTAGGAGAA
AAACTAACAGATGAAGAAGTAGATGAAATGATCAGAGAAGCAGATATTGATGGAGACGGA
CAAGTCAACTATGAAG
gtaaaactaaattctctgagctcagtgtttcatagtcttacctttagatctgtaagcaag
ccaactgcttcactagacagcctttgactttattttatgtacagtaaagatgttgtgttc
attaaagctgttttcaaagataaccaaaagttactattatatttgtcttttcagaattcg

 1.08 Term +   8920   8933   14  2  2  107   41     4 0.815  -4.04
aagccaactgcttcactagacagcctttgactttattttatgtacagtaaagatgttgtg
ttcattaaagctgttttcaaagataaccaaaagttactattatatttgtcttttcagaat
tcgtacagatgatgactgcaaaatgaagacctactttcaactcctttttcccccctctag
AAGAATCAAATTGA
atcttttacttacctcttgcaaaaaaaagaaaaaagaaaaaagttcatttattcattctg
tttctatatagcaaaactgaatgtcaaaagtaccttctgtccacacacacaaaatctgca
tgtattggttggtggtcctgtcccctaaagatcaagctacacatcagttttacaatataa

 2.02 PlyA -   8986   8981    6                               1.05
 2.01 Term -   9520   9356  165  1  0   82   40   166 0.449   9.12

Predicted peptide sequence(s):


>CALM1_1|GENSCAN_predicted_peptide_1|287_aa
XPSPRQLKECGQSASTSPRTPYSQDLLQHPKLEVAAADPRTRGTREPAALVERLEMLSGA
GSVVDAVPLLVVRRRRRRRRRHSAQRALAAAAAAAASEPLDCQMRLCASLGVFSTAPSSS
ACRADITDCVSGLAGGEMVPRRVLADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVM
RSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDG
NGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEESN

>CALM1_1|GENSCAN_predicted_peptide_2|54_aa
NNADNAKPTYTGMPPGCVIVTMGRSTRSTRGPSYQWGHVSTVYPSPIFLHVILR