GENSCAN 1.0	Date run: 15-Jan-104	Time: 08:27:41

Sequence BCL11B_1 : 104598 bp : 50.75% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +   1429   1525   97  0  1   80  105    79 0.627   8.38
aacagcatagaagaaagagcaaaataaagaagaagaagaggaggaagagagggaaagaga
ggaagggaaaaaaaacaccaacccgggcagaggaggaggtgcggcggcggcggcggcggc
ggcagcggcggcagcggcgcggcggcggctcggaccccctcccccggctccccccatcag
TGCAGCTCTCCGGGCGATGCCAGAATAGATGCCGGGGCAATGTCCCGCCGCAAACAGGGC
AACCCGCAGCACTTGTCCCAGAGGGAGCTCATCACCC
gtaagtgtctgcggagtgcgcgcgaggggccggagatggggctccgggcgtctggggctg
gggacaccgagcccggaacagccgagcctggccaggcgccggggccgcccgctggctggc
agagtctacggcgtcggcctggagcatggcggggggcgggggccataggaaagtttcttt

 1.02 Intr +   9224   9361  138  0  0   68   85    22 0.407   0.34
agctgcttaagcatcctaaaattaggctggagtcctgcaaacaatctgtacacagggaga
ccctccccaaacattcgactttcccgcctggagtctgtagaccagaaggtatgggagtga
gcctcttcctgcatctaaaacctcttcacggatctggagtttccacctcctggcctgcag
GCCAGGCCCAAAGTTTCCGCTGCTGGCGGAGTCAGCGGGACCCTGGTCATTTTCCTGGGA
AGCCCACACTGGGAAGCATGTTTTGCACCGGCCGCCTTCCCTTGCTCTCCCTCTCACATG
TCAGAAACGGCGATCGAG
gtgtgtgcctcagctgaggaggggcagacaggacctcatggggtggtggctgtggtatgt
atctgtccctccagggaggcagcctttggagggtgtcaggagggtgcagagctgacctgg
agcaggctggactcctctgactgtctgctgagagggtcgagggtcaggacagagaggtgt

 1.03 Intr +  14847  15215  369  1  0  107   80   411 0.769  37.28
tgtcctgtgggggatgctcaccagcccccaaccccggggaggacctggtgagctctggca
gccagcagcagagggggctgcttcttggcggggaaggggtggaccggaagttgggtgctg
tgaccgcctaagcccatctctatcttctctgccccttccctttcttctttctgtctccag
CAGAGGCTGACCATGTGGAGGCCGCCATCCTCGAAGAAGACGAGGGTCTGGAGATAGAGG
AGCCAAGTGGCCTGGGGCTGATGGTGGGTGGCCCCGACCCTGACCTGCTCACCTGTGGCC
AGTGTCAAATGAACTTCCCCTTGGGGGACATCCTGGTTTTTATAGAGCACAAAAGGAAGC
AGTGTGGCGGCAGCTTGGGTGCCTGCTATGACAAGGCCCTGGACAAGGACAGCCCGCCAC
CCTCCTCACGCTCCGAGCTCAGGAAAGTGTCCGAGCCGGTGGAGATCGGGATCCAAGTCA
CCCCCGACGAAGATGACCACCTGCTCTCACCCACGAAAGGCATCTGTCCCAAGCAGGAGA
ACATTGCAG
gtatgggatgctgcgcttgcctggttgctgtggaagccacctcctgggtcccatgccctc
tgcctgagtgtgctggtgcaggggaaggcccaggggcttccaggatggcctctgggccac
cagccggggctccccctttctgagggtccaccatccaggtgaccttcaggaggagacagg

 1.04 Intr +  21827  21906   80  0  2   90  116   -25 0.001  -0.23
ccactggccttccagggaggcggtggacccacctgccatgtgaactgtgcaaaccagagt
caagagtgtgtgccgctaacatggtgacatcagcaccgattgtagttgaaagttttattg
gattaaaaaaaagacagacaatactggtcacataaatgggtgttttttttttctcttaag
GTTTGAGGCCTTATTTATTGTTTTATGTACGTAGTTCCATACTTCCAGCAGTAATTCAGG
AAACAGGAGAGAGAGATAAG
gtaagaaaaagagagaaaggcagctgggctcccaaggggtgaacttaaccaacattcagc
ctgagttaatattattattcttagtttgtctatttgacagtaaatagttagtattgacta
aagtttttttaatcaggcatttgacagcttttttgagtggttgttgctcatttgcatgct

 1.05 Intr +  28770  28880  111  2  0  114   38    43 0.005   2.48
gatcttcctcgaggagaactggtagcccccagggtgctctggcgtctttgcagggcacac
tttctgcgcctgagtggcagggtaggctgccctgcagtgtgtgcttccgagccctgccat
gtgtctgtagggcactttccttgcttttttttttttttttttttttttttttttttttag
GAGCAATGTGTGGGAGATTTGCCTGGAAATGGGGGGTTCTGTCAGCTGGATCATGTTGAA
ATACCAGTGCAATTGGTAGCCAAAGGGATCCTGGAGAAGCCTCCTTCGGAG
gtgctgtgttaagcatcttcaattttattgctttgagaagcctagatttttgtataggat
ttcctacaagggtgcttccagagtggcacctgagtcctgcttagaggttcaataatattt
gttgttgctggagcgtcaggggccgtgtcgttgttaaagccgcagaatctagaggttggc

 1.06 Intr +  38815  38930  116  0  2   93   54   159 0.664  12.25
tttgggcttttgcagtagcttcagatttcttgagttccacccttgggaagggctctgggt
ttgagctgccccgtgtggaaacctctcccagtgtagaaggtgctctgggagccccagaga
ggccctgtagagcttgggatttgaagcccctctcccggctgcccccctcccctgcctcag
TTGAGCCGGTCCCTGGAGCAGGTGGACTTCAGCAAGGTCACAATTGCTAATGAGACTCTG
GGGAAACCTGTCCAGGGCGGCCTACCCCCTGACCCCTATGCAGGGAACAACGTGTG
gtgtgtgacatcgcctttacagaccctggtctgagccccaccttggacgtttccaggaga
agggtgtggccagatgcctgttttctacctgctctgcaacggttcctcccaccacggaga
cagagtcagcttcttagcacctgggacaacccttaccaggcctcgagctgcttctgctgg

 1.07 Intr +  41129  41278  150  2  0  142   33    10 0.075   0.18
cgagcccattccctcgcctgtgtcccgattgccttccctgcagggcctggcaccccgggg
gcctcccacccccgaagggtggcctgagcagagccccacgccccgagccccgtcccaccc
cgtgcccctcacacagtccagggcccgactgaccagtcttttctattgttttttctccag
GGCCGTGCAGGCCTGCCCAGCTGCCAGCGGTGGCCCCCATAGCTGCCTCCTCCCACCCTC
ACTCATCCGTGATCACTTCACCTCTGCGTGCCCTGGGCGCTCTCCCGCCCTGCCTCCCCC
TGCCGTGCTGCAGCGCGCGCCCGGTCTCGG
gtgacgggactcagggtgagggtcagacggaggctccctttggatgccagtgtcagttgt
caggtaacagacgacgccgcggtggggggcgggcccccgggatggcggggtgtgccatgg
gcagcgctggagcaaggtggggacccagggaggaagggcagctcccacccagaaggcttt

 1.08 Intr +  42193  42250   58  1  1   89   77    18 0.114  -0.31
attctacagatgggcagatgggccggtgtggtgacacaaactggcctctacctgccctgc
ttctccccaagtggaacccaagatcttattctgcctagggtctctgggaatccttggggt
ccttgggaattcaagggcaaagggccctctcacaagtctgtccccccggcatctcggcag
GGCCTGGCGTGAAAGCACTGTGGCCACGCAAACCAGGATGCTGACACAGACACATGTG
gtgagcagccgtggcctggtttctgtggcaggggcaggaaaggagaaggggggtgcagag
ctggggcagatttgattggtccctgctttgtcaccaggcatgttgcaggctttctctcga
cttgaattgtgaaaggaaaactatttttattgggcaggttgtgtttttaattgaagctgt

 1.09 Term +  42880  42978   99  0  0   65   39   103 0.251   1.23
ggaaccacttgcaaagacgccggctcccttttctgggctgtgctggtccccaggtgctca
ggcctcctgtcctggttcagtagatctgttctgtgagtctgtggaaggccctgcttgctg
agcagggggtgcctgctctgtctgggtggttgccttgctctcgtggcttcctgtcattag
CGCTGCAGCCTCGGCAACCACTGGGGGGGCCATGCTATCGAAGATCAGCCTGAGTGTTTA
TTACTGGACGCGGTCAAGTTCCGTGGCACAGAAATCTGA
tctcaccagaggctcacccagggctttgcttaaccctctgttggccctacttagaagttg
ctgaagtagatgagactcagctagaggactgagccgctccctcatgtggccaggcctgct
tagcatctttgtatggtgctgaccaggagctgttaccatccccattttgcagatggagaa

 2.11 PlyA -  47518  47513    6                               1.05
 2.10 Term -  48045  47986   60  0  0  119   44    65 0.395   3.00
 2.09 Intr -  51003  50864  140  1  2   54   73   117 0.365   6.98
 2.08 Intr -  57909  57755  155  2  2   77  109     1 0.035   0.82
 2.07 Intr -  62121  62032   90  2  0   59   64    84 0.304   2.21
 2.06 Intr -  67403  67172  232  0  1   11   58   238 0.153   9.93
 2.05 Intr -  74072  73889  184  2  1  -17   65   112 0.050  -2.24
 2.04 Intr -  74959  74771  189  1  0  -24   80   183 0.803   6.08
 2.03 Intr -  76079  75820  260  0  2  114   49    93 0.654   5.18
 2.02 Intr -  78466  78348  119  0  2  105   99    61 0.958   9.01
 2.01 Init -  78547  78510   38  1  2   86   61    39 0.560   0.53
 2.00 Prom -  83245  83206   40                              -5.86

 3.01 Init +  89176  89258   83  0  2   92   66   109 0.877   7.55
cagtgcctactgtatgtgggtccctatttggggtattttaccacgacgagccctcatcct
acagcgaacgacccaggaaggcaggtattgttttccctgtgtggatgaggaccctgaagc
cctgtggtgtccagcaacttggccgaagtgtctgggctttgaagtgggtctggaaggaac
ATGGCTCGTGCTGGCAGGAGGCTGAGAAGACTCCTGGTCTGTCGGATGTCTCGGCCGCTG
GCAGTCCTGAAGTGCAACTTTGC
gtgagtcaccatgttgcaggctggtgtccaagcagtccacaagaccagcgcagtccctgt
cctcaaggagcttggagtctggaagatgaattttaaataaataagctaaggtcactaatt
tcttcttgagcaacttatccaagttctctgggcttcccttatttcttcggtcaatggtca

 3.02 Intr +  90377  90477  101  2  2   81   79    36 0.495   1.75
tacgtgggctgaaatgaaaggtaaaatactgaggcccaggtagctagccccatccctgcc
cggagtgtgtctgctgctcttctgacccagcgtttatcagaacagcataacaagagcaca
ggctttaccgtgggcagctgtgcagccccaggcggatcccctatctcttcccgtcctcag
TTTCTTCATCTGTAAAATGGTCATCATGACGGTGGGTACTGCAGGGGTTGTTGGAGCAGC
ATGTGAGGTCCTTGGTGTGCTTAGCTCATGCCTGGCAGGTG
gtaaggatttcataaagctttcttgttaccactgtgagtgttatttccccagttccgcct
ttgtcttggagagagctgaggtttcacggaatacatttggaacaggcagggatggttatc
aattctgcagatggctgtgcccagaatgatatagacacgaaacttaaatagatccctgcg

 3.03 Intr +  91026  91105   80  1  2  116   32    78 0.496   4.27
gtactgggtaccctgaagtccagagtggggaagggagctgccacagggggccctgggatc
tggtttcccatccctggatttggccacttcggtgtctacctcacgaggtccccagtgacg
tgtcataccccgcaggctcgcttgctcgctctgtgaaacgtctccccttctcctctccag
GGTCAAGGCCTGTGGTGGACCTGACCGGGTTCCAACCAAACATCATCAGTGCCTTCCACT
GGGAGGACACTCACAGTGTG
gtgggagaacctccttcgtggccatttgcattgtgaaacaggccctgacgataaatgcct
caggtggtgctgtgtgccgaggcggggctggagccctgctcaggggttgggaagcctgag
gaggagcgtggcctgcccctttctggccgtgccgctttgcttctctgagcgtcagtttgc

 3.04 Intr +  93014  93145  132  1  0   31   95    90 0.464   4.84
agataaccatggagtgataataaggaaatgaatgttttattaaaaaaagaagggagtggg
gactggaaagaaagttgtctagggcgggcctctgagggctgggtgatttttaggatatcg
gaaggcttcagatcctgcactggaggccatcgcctgaagtgaaatcttgccattgtgcag
AGGGAAGTATTGGAACCAAAGCGGTTCCCGGACACGGGTCCAGTAAGAGCTTTCCAGGCA
GGACGGGTGGCCCTGAAATCCAGCCTGATGAATAAACATCGCTCTTCTCACCTGATGGTG
AATTATGGACAG
gtaatgccctccctatgttgctccaagttagttttagaagcttttttttttttttttttt
tttttttaagatggattctcattctgtcgcccaggctggagtgcagtggttcgatctcag
ctcactgccacttccgtctcccgggttcaagcgattctcctgcctcagcctcctgagtag

 3.05 Intr +  95322  95439  118  2  1   15   48    99 0.458  -1.36
gtgagtgcaatgctgcaagacgggtcctgtctgcaccgtctcttttatgcagagcattag
gagaggtacatactggaaaagcggcgagcttcacccccaggtgcaggagggcacttgcag
gatgggttccggaggaaatgttcagcctccattttgtgattgtctcagtgatggacacag
ACGATGACGTTTTGGCTCCATACCACGAGTGTTCGCTACAATTTGCTGCCCGTGTCACCA
GAGCCAGTTGCTAACACATCAGCATTTGCCACTGTTCATCCTGACTGCCCTGTCAGAT
gtgaggatgttctttcattgcttagtattctggcagaggactttgaaagactcatgtagg
ccagtgtgcccccgccttccctggggtctggaggtggaattccaagcggtgtttgggcgt
gtgtgtgaggacacggggtgggggcagctgtcacagtagtagccggtcttcacagcatgt

 3.06 Term +  96491  98535 2045  0  2  115   47  4227 0.999 406.67
ccagccaggaggagacaaggccgggcctgcttgcaagcggccctgcagcccctgtcaggc
agggcactgggatcccggatcagcccgggccgcgtcccccaggccagtggccctgcggtg
cccgcgccccgctgccgcttctcacgctgtctctgcctttctgtccgtgtgtttccccag
GTAAAGATGAGCCTTCCAGCTACATTTGCACAACATGCAAGCAGCCCTTCAACAGCGCGT
GGTTCCTGCTGCAGCACGCGCAGAACACGCACGGCTTCCGCATCTACCTGGAGCCCGGGC
CGGCCAGCAGCTCGCTCACGCCGCGGCTCACCATCCCGCCGCCGCTCGGGCCGGAGGCCG
TGGCGCAGTCCCCGCTCATGAATTTCCTGGGCGACAGCAACCCCTTCAACCTGCTGCGCA
TGACGGGCCCCATCCTGCGGGACCACCCGGGCTTCGGCGAGGGCCGCCTGCCGGGCACGC
CGCCTCTCTTCAGTCCCCCGCCGCGCCACCACCTGGACCCGCACCGCCTCAGTGCCGAGG
AGATGGGGCTCGTCGCCCAGCACCCCAGTGCCTTCGACCGAGTCATGCGCCTGAACCCCA
TGGCCATCGACTCGCCCGCCATGGACTTCTCGCGGCGGCTCCGCGAGCTGGCGGGCAACA
GCTCCACGCCGCCGCCCGTGTCCCCGGGCCGCGGCAACCCTATGCACCGGCTCCTGAACC
CCTTCCAGCCCAGCCCCAAGTCCCCGTTCCTGAGCACGCCGCCGCTGCCGCCCATGCCCC
CTGGCGGCACGCCGCCCCCGCAGCCGCCAGCCAAGAGCAAGTCGTGCGAGTTCTGCGGCA
AGACCTTCAAGTTCCAGAGCAATCTCATCGTGCACCGGCGCAGTCACACGGGCGAGAAGC
CCTACAAGTGCCAGCTGTGCGACCACGCGTGCTCGCAGGCCAGCAAGCTCAAGCGCCACA
TGAAGACGCACATGCACAAGGCCGGCTCGCTGGCCGGCCGCTCCGACGACGGGCTCTCGG
CCGCCAGCTCCCCCGAGCCCGGCACCAGCGAGCTGGCGGGCGAGGGCCTCAAGGCGGCCG
ACGGTGACTTCCGCCACCACGAGAGCGACCCGTCGCTGGGCCACGAGCCGGAGGAGGAGG
ACGAGGAGGAGGAGGAGGAGGAGGAGGAGCTGCTACTGGAGAACGAGAGCCGGCCCGAGT
CGAGCTTCAGCATGGACTCGGAGCTGAGCCGCAACCGCGAGAACGGCGGTGGTGGGGTGC
CCGGGGTCCCGGGCGCGGGGGGCGGCGCGGCCAAGGCGCTGGCTGACGAGAAGGCGCTGG
TGCTGGGCAAGGTCATGGAGAACGTGGGCCTAGGCGCACTGCCGCAGTACGGCGAGCTCC
TGGCCGACAAGCAGAAGCGCGGCGCCTTCCTGAAGCGTGCGGCGGGCGGCGGGGACGCGG
GCGACGACGACGACGCGGGCGGCTGCGGGGACGCGGGCGCGGGCGGCGCGGTCAACGGGC
GCGGGGGCGGCTTCGCGCCAGGCACCGAGCCCTTCCCCGGGCTCTTCCCGCGCAAGCCCG
CGCCGCTGCCCAGCCCCGGGCTCAACAGCGCCGCCAAGCGCATCAAGGTGGAGAAGGACC
TGGAGCTGCCGCCCGCCGCGCTCATCCCGTCCGAGAACGTGTACTCGCAGTGGCTGGTGG
GCTACGCGGCGTCGCGGCACTTCATGAAGGACCCCTTCCTGGGCTTCACGGACGCACGAC
AGTCGCCCTTCGCCACGTCGTCCGAGCACTCGTCCGAGAACGGCAGCCTGCGCTTCTCCA
CGCCGCCCGGGGACCTGCTGGACGGCGGCCTCTCGGGCCGCAGCGGCACGGCCAGCGGAG
GCAGCACCCCGCACCTGGGCGGCCCGGGCCCCGGGCGGCCCAGCTCCAAGGAGGGCCGCC
GCAGCGACACGTGCGAGTACTGCGGCAAGGTGTTCAAGAACTGCAGCAACTTGACGGTGC
ACCGGCGGAGCCACACCGGCGAGCGGCCTTACAAGTGCGAGCTGTGCAACTACGCGTGCG
CGCAGAGCAGCAAGCTCACGCGCCACATGAAGACGCACGGGCAGATCGGCAAGGAGGTGT
ACCGCTGCGACATCTGCCAGATGCCCTTCAGCGTCTACAGCACCCTGGAGAAACACATGA
AAAAGTGGCACGGCGAGCACTTGCTGACTAACGACGTCAAAATCGAGCAGGCCGAGAGGA
GCTAA
gcgcgcgggccccggcgccccgcacctgtacagtggaaccgttgccaaccgagagaatgc
tgacctgacttgcctccgtgtcaccgccaccccgcaccccgcgtgtccccggggcccagg
ggaggcggcactccaacctaacctgtgtctgcgaagtcctatggaaacccgagggttgat

Predicted peptide sequence(s):


>BCL11B_1|GENSCAN_predicted_peptide_1|405_aa
CSSPGDARIDAGAMSRRKQGNPQHLSQRELITRQAQSFRCWRSQRDPGHFPGKPTLGSMF
CTGRLPLLSLSHVRNGDRAEADHVEAAILEEDEGLEIEEPSGLGLMVGGPDPDLLTCGQC
QMNFPLGDILVFIEHKRKQCGGSLGACYDKALDKDSPPPSSRSELRKVSEPVEIGIQVTP
DEDDHLLSPTKGICPKQENIAGLRPYLLFYVRSSILPAVIQETGERDKEQCVGDLPGNGG
FCQLDHVEIPVQLVAKGILEKPPSELSRSLEQVDFSKVTIANETLGKPVQGGLPPDPYAG
NNVWAVQACPAASGGPHSCLLPPSLIRDHFTSACPGRSPALPPPAVLQRAPGLGAWREST
VATQTRMLTQTHVRCSLGNHWGGHAIEDQPECLLLDAVKFRGTEI

>BCL11B_1|GENSCAN_predicted_peptide_2|488_aa
MMEKTKYQEAQGSPSTEQVLLAPDCPPAAEVTVSKPPRPSPDCTGLQNTPSSAVLTDAPQ
DSQELKPQQFHRSAAHWIDVCPPSERIPVSTREGTLQTEQELCVQGVCKPTRSKNPNACQ
GCVIQLEHRAPSHEHLINQPETKQTDGWSGDSETEAINWTAACEGDILTKCPPFWVMHPQ
PQKRTADSAVQAPDFQFEAASQNSWIEWYERSRDTFSAIPPAFQTECTFRTFRTFRNALL
CTHQNSPIWANPKTQEYLFHPTPGSQTLKMSIRGQSLTETAQASRASGGFAFTLVLHKFD
GLGKFADSPKACISHFYNDWLNAPKDQALATPACQERGGATLPQEPKQLMPEDQETDFPS
FGSTPRLFLLSSILFPWPQQVDVLLADGWLLKQGRGHRGQEVSAGLRLQHPGTAISRLKN
STDAQGKQFRICENQERSCHLSPVNYKRSCLESPNSELGEKAPPGHPIAVLVMGCGHAQM
VAVHGTCQ

>BCL11B_1|GENSCAN_predicted_peptide_3|852_aa
MARAGRRLRRLLVCRMSRPLAVLKCNFAFFICKMVIMTVGTAGVVGAACEVLGVLSSCLA
GGSRPVVDLTGFQPNIISAFHWEDTHSVREVLEPKRFPDTGPVRAFQAGRVALKSSLMNK
HRSSHLMVNYGQTMTFWLHTTSVRYNLLPVSPEPVANTSAFATVHPDCPVRCKDEPSSYI
CTTCKQPFNSAWFLLQHAQNTHGFRIYLEPGPASSSLTPRLTIPPPLGPEAVAQSPLMNF
LGDSNPFNLLRMTGPILRDHPGFGEGRLPGTPPLFSPPPRHHLDPHRLSAEEMGLVAQHP
SAFDRVMRLNPMAIDSPAMDFSRRLRELAGNSSTPPPVSPGRGNPMHRLLNPFQPSPKSP
FLSTPPLPPMPPGGTPPPQPPAKSKSCEFCGKTFKFQSNLIVHRRSHTGEKPYKCQLCDH
ACSQASKLKRHMKTHMHKAGSLAGRSDDGLSAASSPEPGTSELAGEGLKAADGDFRHHES
DPSLGHEPEEEDEEEEEEEEELLLENESRPESSFSMDSELSRNRENGGGGVPGVPGAGGG
AAKALADEKALVLGKVMENVGLGALPQYGELLADKQKRGAFLKRAAGGGDAGDDDDAGGC
GDAGAGGAVNGRGGGFAPGTEPFPGLFPRKPAPLPSPGLNSAAKRIKVEKDLELPPAALI
PSENVYSQWLVGYAASRHFMKDPFLGFTDARQSPFATSSEHSSENGSLRFSTPPGDLLDG
GLSGRSGTASGGSTPHLGGPGPGRPSSKEGRRSDTCEYCGKVFKNCSNLTVHRRSHTGER
PYKCELCNYACAQSSKLTRHMKTHGQIGKEVYRCDICQMPFSVYSTLEKHMKKWHGEHLL
TNDVKIEQAERS