GENSCAN 1.0	Date run: 15-Jan-104	Time: 07:24:09

Sequence ACTR10_1 : 37064 bp : 38.96% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1281   1357   77  2  2   86   89   105 0.854  11.16
ggtgggtccaacgcggaatgaggcacagcctgggacagcccgggcccggcgcgccgcggc
cgcgcgaggcccccgccgtcgccgacgcccgagcgccggagccccggccccgccccgcga
gcgccgagacttgttggccgcggagactgcgaccctcttctctcagtctgccttactacc
ATGCCGCTCTACGAGGGCCTGGGGAGCGGCGGGGAGAAGACGGCGGTCGTGATCGACCTG
GGAGAGGCCTTTACCAA
gtgagtggccgtgacgccagctgtgttcgacccgaggggagggcgggtggcagagcccca
ggcactgcctgggtcctcatcgccgactcgctgggcagctccgggcctccccttttcttc
aaccagcgcccttgcaaataacagctcttattatttcctccctgggcgatgcgaatccga

 1.02 Term +   1484   1649  166  2  1   71   50   130 0.752   3.91
gagcggcggggagaagacggcggtcgtgatcgacctgggagaggcctttaccaagtgagt
ggccgtgacgccagctgtgttcgacccgaggggagggcgggtggcagagccccaggcact
gcctgggtcctcatcgccgactcgctgggcagctccgggcctccccttttcttcaaccag
CGCCCTTGCAAATAACAGCTCTTATTATTTCCTCCCTGGGCGATGCGAATCCGAGGATCG
GGGTCTGACTCCCAGAGAGGCCCAGAAAGCTTCTGTTGAATTGCCCTCGTCGCCGCCCCT
TGTCATCACCCCAAACCCAACAAACCCTTTGGGATCATCTGTGTAG
gggatgacaaccgtgacctagaccccgcttaccctgggctcctcagttgaggaaggcagc
caaccgaatgtaaatgctcgatgacgaatttcatcataaaatattgaacggagtttattt
tggtgctgaaaatggaaagatgtttaagacagggctatcgctgctcaagaattagggaga

 2.01 Init +  24388  24436   49  0  1   86   58    53 0.847   1.26
tttttctttgagatggagtttcacttttgttgcccaggctggagtgcagtggcgcgatct
cggctcactgcaacctccacctcccgggttcaagcaattctcctgcctcctcctccggag
cagctgggattacaggcacccgccaccacgcccggctaattttttgtatttttagtagag
ATGGGGTGTCGCCCTGTTGGGCAGGCTGGTCTCGAACTCCTGACCTCAG
gtgatccgcctgcctcggcctcccaaagtgctgggattacaggcaagagccactgcacct
ggccaaaacaggttttttaatgaacaaattattgttagctaactaaagatgggaatagag
tttataaaatccaaaggaatagatgatgagcatgttcacttgaatagaattgttttaact

 2.02 Intr +  24685  24764   80  2  2   87  107    49 0.948   5.05
caggttttttaatgaacaaattattgttagctaactaaagatgggaatagagtttataaa
atccaaaggaatagatgatgagcatgttcacttgaatagaattgttttaactggggtgta
ggtacactctgttcaattataataactagccataataaggtctccttttcttccttaaag
CGCGTACTTGCTTTGTAAGTGATCTGAAGCGAGGACTAAAAATCCAAGCAGCAAAATTTA
ATATTGATGGGAATAATGAG
gtaagtttaaaaaaaaaaaaggcatctttttgcaaaggttacaacatgtgtggacttatg
tttatgatatttatatttcagcgtccctccccacccccaaatgttgactatccattagat
ggagagaagattttacatatccttggatcaatcaggttagatcttaaatttttacggcaa

 2.03 Intr +  33129  33330  202  2  1   72   94    91 0.936   6.04
ttgctacatgaaagaaaccttgctgtggccctttttgcgatacaaacgatcacctgttta
atctgtagtataataataatatgtataataatagtatatttatgtatattttcttaagtt
caatcaagcattatttgtacagttcagaataaatccttctttttttctttttaataacag
TGTCCGATAGACACCAGGAAGCAACTAGCAGAGAATTTGGTAGTCATAGGTGGCACTTCT
ATGTTGCCAGGATTTCTCCACAGATTGCTTGCAGAAATAAGGTATTTGGTAGAAAAACCA
AAATATAAAAAAGCACTTGGCACTAAGACATTTCGAATTCATACTCCACCTGCAAAAGCT
AATTGTGTGGCCTGGTTGGGAG
gtaagaatttcacttttaaaatataatgattatatagtatttggtctctgaatgacacta
ttaatggatatattagaataaataattcagggttcagaattgcccactttataaatagaa
ctaacactgactttttctttttttttttttttttttttttttttgagacggagtctcact

 2.04 Term +  35433  35614  182  1  2   57   43   145 0.990   3.69
cctgttattcaaaatgtaaaataaagaatggcttaactggaattactttgaagattgtgg
ctatgcattgctgaattttaccagtccacttttgtcatatagtgaagtagatgtatgtgt
acataaagttttctggtaaaagttttcatcttagctataaaaaatatttttgtcacacag
GGGCTATTTTTGGAGCATTACAAGATATACTTGGGAGCCGTTCTGTTTCAAAGGAATATT
ATAATCAGACGGGCCGTATACCTGATTGGTGTTCTCTCAATAACCCACCTTTGGAAATGA
TGTTTGATGTCGGGAAAACTCAACCACCTCTGATGAAGAGAGCATTTTCCACTGAGAAAT
AG
aagtttgattaaaaatcaaccttgcttcatatcaaatatttaaccaattataagcaaatt
gtacaaagtatgtaggatgttttgttatagaggactatagtggaagtgaaagcattctgt
gtttactctttgcattaatatataattcttttgactttgtttctcttgtgtagtggtaaa

Predicted peptide sequence(s):


>ACTR10_1|GENSCAN_predicted_peptide_1|80_aa
MPLYEGLGSGGEKTAVVIDLGEAFTNALANNSSYYFLPGRCESEDRGLTPREAQKASVEL
PSSPPLVITPNPTNPLGSSV

>ACTR10_1|GENSCAN_predicted_peptide_2|170_aa
MGCRPVGQAGLELLTSARTCFVSDLKRGLKIQAAKFNIDGNNECPIDTRKQLAENLVVIG
GTSMLPGFLHRLLAEIRYLVEKPKYKKALGTKTFRIHTPPAKANCVAWLGGAIFGALQDI
LGSRSVSKEYYNQTGRIPDWCSLNNPPLEMMFDVGKTQPPLMKRAFSTEK