GENSCAN 1.0	Date run: 15-Jan-104	Time: 06:02:06

Sequence UBL3_1 : 87637 bp : 36.53% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Term +    104    280  177  1  0   82   54   245 0.735  17.20
gaaagggagctttcctttcctcgcaactgttgctatggggggcgtggcttcggagctggg
tgaggaggcgttcggcggctccctcccccccccaccctcgtagACTACACTTCCCGTGATGCTCGAGGGAATGGTCTCCGTGGTGACGCACTTGGTGTCCGCG
GAGGGAGGACGAGGACGGGGGCGGCGGCTGCTGCGAGGGGGGGCCCGTGCTCTCCCCGTT
TCCCTTAGTCGCACTCAGGCAGCCGCCGCCGCCGCCGCTGCCGCCATGTTGGTTTGA
gaggcgatgacaggaggcggccgcggcgtgtgggactgaaaagtgaaggaggaggaggag
aaacaaagctctgagaggaaaccattcccgggctgaggagaaggaggacccggcctcttc
cggggaccagccgaagtcggcgtcgcccggagctcgcgaggccggggaggggaggggaag

 2.01 Init +  22722  23029  308  2  2   60   81   138 0.451   7.11
aagtgatggggagaatggaaccaagttggaaaacactctgcagaatattatccaggagaa
cttccccaacctagcaatgcaggccaacattcaaattcaggaaatacagaggatgccaca
aagatactcctcgagaagggcaactccaagacacataattatcagattcaccaagttgaa
ATGAAGGAAAAAATGTTAAGGGCAGCCAGAGAGAAAGGTCGGGTTACCCACAAAGGGAAG
CCCATCAGACTAACAGCTGATCTCTTGGCAGAAACTCTACAAGCCAGAAGAGAGTGGGGG
CCAATATTCAACATTCTTAAAGAAAAGAATTTTCAACCCAGAATTTCATATCCAGCCAAA
CTAAGCTTCGTAAGTGAAGAAGAAATAAAATCCTTTACAAACAAGCAAATGCTGAGAGAT
TTTGTCACCACCAGGCCTGCCCTAAAAGAGCTCCTGAAGGAAGCACTAAACATGGAAAGC
AACAACAG
gtaccagccactgcaaaaacatgccaaatagtaaagaccatcaatgctaggaagaaactg
catcaactaatgagcaaactaaccagctaacatcataatgacaggatcaaattcacacat
aacaatattaaccttaaatgtaaatggactaaatgctccaattaaaagacacagactggc

 2.02 Term +  25120  25516  397  1  1   68   45   189 0.520   6.16
ccttcatgctaaacattctcaataaattagatattgatgggacgtatctcaaaataataa
gagctatctatgacaaacccacagccaatatcatactgaatgggcaaaaactggaagcat
tccctttgaaaactggcacaagacagggatgccctctctcaccacttctattcaacatag
TGTTGGAATTTCTGGCCAGAGCAATCGGGCAGGAGAAAGAAAGGGTATTCAATTAGGAAA
AGAAGTTAAATTGTCCCTGTTTGCAGATGACATGATTGTATATTTAGAAAACCCCGTCGT
CTCAGCCCAAAATCTCCTTAAGCTGATAAGCAACTTCAGCAAAGTCTCAGGTTACAAAAT
CAATGTGCAAAAATCACAAGCATTCTTATACACCAATAACAGACAAACAGAGAGCCAAAT
CATGAGTGAAATCCCATTCACAATTGCTTCAAAGAGAATAAAATACCTAGGAATCCAACT
TACAAGGGATGTGAAGGACCTCTTCAAGGAGAACTACAAACCACTGCTCAACGAAATAAA
AGAGGACACAAGCAAATGGAAGAACATTCCATGCTGA
tggataggaataatcaatatcgtgaaaatggccatactgcccaaggtaatttatagattc
aatgccatccccatcaagctaccaatgactttcttcacagaattggaataaactaaagtt
catatggaaccaaaaaagagcccacattgccaagacaatcctaagccaaaagaacaaagc

 3.01 Init +  26064  26479  416  2  2   71   53   155 0.208   6.29
tgcctatttaacaaatggtgctgggaagactggctagccatatgtagaaagctgaaactg
gatcccttccttacaccttatacaaaaattaattcaagatggattaaagatttaaatgtt
agacctaaaaccataaaaaccctagaagaaaacctaggcagtaccattcaggacataggc
ATGGGCAAGGACTTCATGTCTAAAACACCAAAAGCAATGGCAACAAAAGCCAAAATTCAC
AAATGGGATCTAATTAAACTAAAGAGCTTCTGCACAGCAAAAGAAACTACCACCAGAGTG
AACAGGCAACCTACAGAATGGGAGAAAATTTTTGCAATCTACTCATCTGATAAAAGGCTA
ATATCCAGAATCTACAAAGAACTCAAACAAATTTACAAGAAAAAAAACAACCCCAGCAAC
AAGTGGGCGAAGGATATGAACAGACACTTCTCAAAAGAAGACATTTATGCAGCCAATGGG
CACGTGAAGAAATGCTCATCATCACTGGCCATCAGAGAAATGCAAATCAAAACCACAATG
AGATACCATCTCACACCAGTTAGAATGGTGATCATTAAAAAGCCAGGAAACAACAG
gtgctggagaggatgtggagaaataggaacacttttacagtgttggtgggactgtaaaac
tagttgaaccattgtggaagacagtgtggtgattcctcaaggatctagaactagaaatac
catttgacccagccatcccattactgggtatatacccaaaggattataaatcatgctgct

 3.02 Intr +  48903  49023  121  0  1   73   23    97 0.169   1.28
ctgttgctccactgcgtggcccctctgtatttcctcaccactgcagctgtgcttcctctc
cctgctctgaaagtgtgggctcctctcccacttaagtggtggctgcaaatctggccttca
tactcccaggctgcacactgctgcccttggatgagctcaggcttcatgttcccttcccag
TTTGGAGGCAACAGGGGAAGGGACCTTGGCAGTGGCTGTGGCAGAGGGCCTTTCACTTGC
CTCTTGGGGCTCCACCCCAGAGAAATGCAGACCCTCTATCAATCAGTGTGTTCGGCCTGG
G
gtggggtggctgcatagtgggctcaagccagggaaccctgcctggtgacgttgagcaatg
gggaaagaggactttgcggggagacagtctggcctcttcttagggtggctatgacttgct
aaaggtatagttaaagcactcagggtcttcactccttccccggtccgagggcaacaaggg

 3.03 Intr +  73584  73692  109  2  1   68   92    49 0.477   2.24
aaataaaatcaaatatcaaattcccattctttttaaaaaagttttatagaatttaaataa
aaaccacaatatggcattggtaataatttaggatgtgattgaaatgaaaagcctttgagt
cttcttttttacttaaaaaatttttagatttatgttaaaagaatcattgtcttctttcag
ATAAATTTGCGCCTCATTTTGGTAAGCGGAAAAACAAAAGAGTTCCTGTTTTCTCCTAAC
GATTCTGCTTCTGACATTGCAAAGCATGTATATGACAATTGGCCAATGG
gtgagtgatatttttctcttgagtatgaataatgttgattcttatgccctaccttgtctc
acaaacattttgaaactgttatataacatttaaaagaacaaccgaaaattgagagtataa
ggctcagatttagaggatcattgtacccttccttatcttgctcttcagcagtctcattcc

 3.04 Intr +  78649  78735   87  2  0   63   77   103 0.697   5.72
aataagtaataaccaaggttgcggtaaatgtatgaatagtgactgtttctaatagtagta
ggaagctccaagggccttctttgtactctaactgatttggatctgaatttttaaaacaat
atagtagtaccttaattatatgttggaatatacctaaccagtacactggattcttttcag
ACTGGGAAGAAGAGCAGGTCAGCAGTCCAAATATTCTACGACTTATTTATCAAGGACGAT
TTCTACATGGAAATGTCACATTAGGAG
gtaacagccacctttgtaatgggatttaatgtctgtctcatggtagcatgattcgcttgt
tttaaatgttaatgtctttgaatttgctaaaaaaaatgataaattcaaactatgaattct
gcctatttctggtatgcctactccttcacattgtatattctgttaaatttagttttagga

 3.05 Intr +  83152  83229   78  2  0   73  121    49 0.644   5.30
taaattttaaatgttatttctgataatattaacctaattttgtgaaggtactctgagtta
agttgaatctgttaaagaagtcataaaaaagcaatcaatttttaaaatggttttaaatct
ggatagtgattttaataggtcgatatatgtgtaactaatcatcttttgcttttcacatag
CATTAAAACTTCCTTTTGGCAAAACAACAGTGATGCATTTGGTGGCCAGAGAGACATTAC
CAGAGCCAAACTCTCAAG
gtaagccatgcactggaaaagtatctcagttgaggcacaaagacaggcattcaaaaatgc
taggtttttcttggatatgctgagggaagggaagtttgcatagtttatgaatagagattg
tcaagcaaataaccagacatttttgaaacatgctaaaattaaaagaacatttattacagc

 3.06 Term +  86538  86557   20  1  2  122   42    11 0.107  -2.60
atgttacagtaatttctgttagctgattgtggtaaacaatgtttaatgtgaaaagaaatt
aaaactttcttcatctgttgtagaatatttctcttctttaaaatggcttctattcataat
tctggtgtatttgcctattctttatttcactactgtttatgtctttttttctttcttcag
TTAATGATACTCTTCAGTAA
aaatcaacattgagccagcctttgctatagtttagcaaaatcaaagggaagtatcagcca
aaatttaatatgccttcataccgtttttatttgtaactttttcgagcattccagtttgtt
ttccatttttgtgttataatatggtcacttgttagccaaatggagtgattggggtggagt

Predicted peptide sequence(s):


>UBL3_1|GENSCAN_predicted_peptide_1|58_aa
TTLPVMLEGMVSVVTHLVSAEGGRGRGRRLLRGGARALPVSLSRTQAAAAAAAAAMLV

>UBL3_1|GENSCAN_predicted_peptide_2|234_aa
MKEKMLRAAREKGRVTHKGKPIRLTADLLAETLQARREWGPIFNILKEKNFQPRISYPAK
LSFVSEEEIKSFTNKQMLRDFVTTRPALKELLKEALNMESNNSVGISGQSNRAGERKGIQ
LGKEVKLSLFADDMIVYLENPVVSAQNLLKLISNFSKVSGYKINVQKSQAFLYTNNRQTE
SQIMSEIPFTIASKRIKYLGIQLTRDVKDLFKENYKPLLNEIKEDTSKWKNIPC

>UBL3_1|GENSCAN_predicted_peptide_3|276_aa
MGKDFMSKTPKAMATKAKIHKWDLIKLKSFCTAKETTTRVNRQPTEWEKIFAIYSSDKRL
ISRIYKELKQIYKKKNNPSNKWAKDMNRHFSKEDIYAANGHVKKCSSSLAIREMQIKTTM
RYHLTPVRMVIIKKPGNNSLEATGEGTLAVAVAEGLSLASWGSTPEKCRPSINQCVRPGI
NLRLILVSGKTKEFLFSPNDSASDIAKHVYDNWPMDWEEEQVSSPNILRLIYQGRFLHGN
VTLGALKLPFGKTTVMHLVARETLPEPNSQVNDTLQ