GENSCAN 1.0	Date run: 15-Jan-104	Time: 05:46:12

Sequence RASA3_1 : 151670 bp : 57.04% C+G : Isochore 4 (57 - 100 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1247   1301   55  1  1  100  109   127 0.925  17.53
ccgggccgcgggcggagcctcccggtccccgccctcgccctcggccaactggcggtcttg
caggcgggcggaccctcggccgcgctcggggctccggcgccgccgctcctcctgctcggc
ctgagctgcccgggctcggcgcgcgcttggggcgaggctcggcgggcgcggacgcgcagc
ATGGCGGTGGAGGACGAGGGGCTCCGGGTCTTCCAGAGCGTGAAGATCAAGATCG
gtgagtgtccgccggcagccacgcgtccgaccccccggcccgaccctgtcctctcccgcg
cccgcctcccctccgcagatccttgctggggaccccggcggagacgccctccaggcgcgg
cgcgctccccggagaacggctggtccggctccgcggcccctccccacctccccgcctccc

 1.02 Intr +   1380   1579  200  1  2  123   59    39 0.792   4.78
gctcggcgcgcgcttggggcgaggctcggcgggcgcggacgcgcagcatggcggtggagg
acgaggggctccgggtcttccagagcgtgaagatcaagatcggtgagtgtccgccggcag
ccacgcgtccgaccccccggcccgaccctgtcctctcccgcgcccgcctcccctccgcag
ATCCTTGCTGGGGACCCCGGCGGAGACGCCCTCCAGGCGCGGCGCGCTCCCCGGAGAACG
GCTGGTCCGGCTCCGCGGCCCCTCCCCACCTCCCCGCCTCCCCGGGCCTCGGGCTGGGTC
GAGTCGGCTCCGGGGTAACGCGGCTCCCTGCGCCTCCTCTGCGCCCGGAGCGGCCCCGGT
CCCTGGTAGCGGCGGAGGAG
gtggggtccctgcgccgagggacgtctgtccgcgtgtgcgcccgagcgtgtgccccgcgt
gtttgcaggagtgcgcgcgcctgaggctgtctgggcgcctgcacttcaggtgtcaaatcc
actgacgtcggggtctcggcatctccctttctccgctgcgcccagaaacttcctttccgg

 1.03 Intr +   2830   2913   84  0  0   78   90    31 0.776   3.47
agcacttccgctttgagtagtccagagaggagggatttcttttgttaatgtggtttaaat
ccgctgtcactttcatacaagaaagccagagctggcgctccctgaagtgcctgaggtcgc
cttgcctgggtggggaaaggtcgcggcccgtgggggtcagtttgctgctctttccttcag
CCAAGGCTGCTTGGCTCAGCCAGCGAGTCTGAGGAGTGTGAGAAGCACTGGGCTTCCTCA
GTCACGGGGGCAGGAGGGCTGGAG
gtgggtgcccctgtggggcagtgccaggtctccaggcagcaggcagaggcggcctggggc
tttgcggctcgggggtggggggcccacagccggcacagcatgctcgctgtgtactccagg
aagggctacacttcaggccacggcaggactttacagaaggcatgggaagtagaacaggag

 1.04 Term +   4310   4327   18  1  0  131   38    -4 0.280  -1.90
agccagcacatttctggggggattgggagctttttttaaggtataggggcattggccatt
taaattcttaaatagctttgaaatgtgtggtggtgtgtggcctcattcagacgttgacat
tgggaaaaatggaaagaatctcttcctcctttcccccttcctctttctttgtccttccag
CTCTTGCAGGTGAGGTAA
taagaggagagcgccacgtagaagtgaggtgctttggtggtaacaatttggagtctttgt
cttgaagaatctggctttctgcatttcagttttgtggaatcattttggatatgtccttct
gtgcacttaaacatcttaaacactgtgtcttttgaaacagtcattaacctttcacagtag

 2.06 PlyA -   5620   5615    6                               1.05
 2.05 Term -   6822   6643  180  0  0  -10   41   153 0.485  -0.62
 2.04 Intr -   7296   7147  150  0  0  102   39    21 0.437   0.15
 2.03 Intr -   7697   7506  192  2  0   52   71   114 0.275   7.00
 2.02 Intr -   7955   7734  222  2  0   52   71   149 0.224   9.15
 2.01 Init -  10667  10317  351  2  0   96   78    92 0.465   4.62
 2.00 Prom -  14905  14866   40                              -4.16

 3.04 PlyA -  15219  15214    6                               1.05
 3.03 Term -  17835  17720  116  1  2   51   48    99 0.486   1.86
 3.02 Intr -  18534  18445   90  1  0   56   81    28 0.442   0.02
 3.01 Init -  20272  19564  709  1  1   65  101   430 0.898  37.50
 3.00 Prom -  20792  20753   40                              -6.94

 4.09 PlyA -  20883  20878    6                              -0.45
 4.08 Term -  21006  20945   62  1  2   88   54    61 0.880   1.57
 4.07 Intr -  21238  21146   93  2  0   58   80    55 0.624   2.80
 4.06 Intr -  23033  22926  108  0  0   54   36   120 0.827   4.82
 4.05 Intr -  23249  23150  100  2  1   66   49    87 0.208   3.45
 4.04 Intr -  24937  24746  192  1  0   51   20   116 0.497   2.00
 4.03 Intr -  25728  25670   59  1  2   54   82    67 0.674   2.44
 4.02 Intr -  26517  26462   56  2  2  107   23    48 0.320  -0.04
 4.01 Init -  26640  26561   80  0  2   84   71   103 0.808   7.49
 4.00 Prom -  26840  26801   40                              -6.05

 5.11 PlyA -  27171  27166    6                               1.05
 5.10 Term -  29746  29053  694  0  1   42   49   569 0.987  42.67
 5.09 Intr -  30383  29770  614  2  2   10  -77   450 0.238  13.31
 5.08 Intr -  30732  30586  147  0  0   56   55   149 0.121  10.02
 5.07 Intr -  33219  33032  188  1  2    6    2   163 0.058   0.12
 5.06 Intr -  34870  34496  375  2  0   33   77   248 0.056  14.49
 5.05 Intr -  35669  35405  265  2  1  -28   80   124 0.155  -1.67
 5.04 Intr -  36140  35980  161  0  2   58    9   129 0.266   2.90
 5.03 Intr -  36997  36883  115  1  1   96   15    35 0.243  -1.81
 5.02 Intr -  37700  37542  159  2  0   47   62    86 0.351   3.28
 5.01 Init -  42522  42403  120  0  0   75   68     3 0.158  -2.69
 5.00 Prom -  42806  42767   40                              -2.06

 6.01 Init +  45776  45940  165  1  0   77   15    82 0.642  -2.42
atttttttttgagacagggcctcactctgtcatccaggctggagtgcagtggtgtgatca
tggctcactgcaacctccacctcctgggatcaagtgatcctcccacctcagcctcacaaa
tagctgggactacaggcgtgcgccaccacgcccagctaattttttgtatttttagtagag
ATGAGGTTTCGCTATGTTGGCCAGGCTGGTCTCCAACTCCTGGGCTCGAGCCATCCGTCA
GCCTCAGCCTCTCAAAATTCTGGTATTAAAGGCAAGAGCCACCGCGCCCGGCTCATTATC
CGATTTAAGGTTTTTGGAAGGAAATGCTGCTCCCAGAATCAGGCT
gtgtgtgttgctgcctccggccctccaaggccctctgataagttgtctgaagttatctgt
cactgaaatgggttgtggtggtgtcgggcgggcgccctgctggccccgggagccgtcagc
cccatgtcagcctggaaggagctccactgagacttggggctctgaggcaggctcgttcct

 6.02 Term +  46957  49266 2310  0  0   26   34  2123 0.910 188.12
ccgtgatttccccgcgaggaggaagggagtcgatactccagactcagcacttccccggga
tttccccgcgaggacgaagggagtcgatactccagactcagcacttccccgggatttccc
cgcgaggacgaagggagtcgatactccagactcagcacttccccgtgatttccccgcgag
GAGGAAGGGAGTCGATACTCCAGACTCAGCACTTCCCCGGGATTTCCCCGCGAGGACGAA
GGGAGTCGATACTCCAGACTCAGCACTTCCCCGGGATTTCCCCGCGAGGACGAAGGGAGT
CGATACTCCAGACTCAGCACTTCCCCGGGATTTCCCCGCGAGGAGGAAGGGAGTCGATAC
TCCAGACTCAGCACTTCCCCGGGATTTCCCCGCGAGGAGGAAGGGAGTCGATACTCCAGA
CTCAGCACTTCCCCGGGATTTCCCCGCGAGGAGGAAGGGAGTCGATACTCCAGACTCAGC
ACTTCCCCGGGATTTCCCCGCGAGGAGGAAGGGAGTCGATACTCCAGACTCAGCACTTCC
CCGGGATTTCCCCGCGAGGACGAAGGGAGTCGATACTCCAGACTCAGCACTTCCCCGGGA
TTTCCCCGCGAGGAGGAAGGGAGTCGATACTCCAGACTCAGCACTTCCCCGGGATTTCCC
CGCGAGGACGAAGGGAGTCGATACTCCAGACTCAGCACTTCCCCGGGATTTCCCCGCGAG
GACGAAGGGAGTCGATACTCCAGACTCAGCACTTCCCCGGGATTTCCCCGCGAGGACGAA
GGGAGTCGATACTCCAGACTCAGCACTTCCCCGGGATTTCCCCGCGAGGACGAAGGGAGT
CGATACTCCAGACTCAGCACTTCCCCGGGATTTCCCCGCGAGGACGAAGGGAGTCGATAC
TCCAGACTCAGCACTTCCCCGGGATTTCCCCGCGAGGACGAAGGGAGTCGATACTCCAGA
CTCAGCACTTCCCCGGGATTTCCCCGCGAGGACGAAGGGAGTCGATACTCCAGACTCAGC
ACTTCCCCGGGATTTCCCCGCGAGGACGAAGGGAGTCGATACTCCAGACTCAGCACTTCC
CCGGGATTTCCCCGCGAGGACGAAGGGAGTCGATACTCCAGACTCAGCACTTCCCCGGGA
TTTCCCCGCGAGGACGAAGGGAGTCGATACTCCAGACTCAGCACTTCCCCGGGATTTCCC
CGCGAGGACGAAGGGAGTCGATACTCCAGACTCAGCACTTCCCCGGGATTTCCCCGCGAG
GACGAAGGGAGTCGATACTCCAGACTCAGCACTTCCCCGGGATTTCCCCGCGAGGACGAA
GGGAGTCGATACTCCAGACTCAGCACTTCCCCGGGATTTCCCCGCGAGGACGAAGGGAGT
CGATACTCCAGACTCAGCACTTCCCCGGGATTTCCCCGCGAGGACGAAGGGAGTCGATAC
TCCAGACTCAGCACTTCCCCGGGATTTCCCCGCGAGGACGAAGGGAGTCGATACTCCAGA
CTCAGCACTTCCCCGGGATTTCCCCGCGAGGAGGAAGGGAGTCGATACTCCAGACTCAGC
ACTTCCCCGGGATTTCCCCGCGAGGAGGAAGGGAGTCGATACTCCAGACTCAGCACTTCC
CCGGGATTTCCCCGCGAGGACGAAGGGAGTCGATACTCCAGACTCAGCACTTCCCCGGGA
TTTCCCCGCGAGGACGAAGGGAGTCGATACTCCAGACTCAGCACTTCCCCGGGATTTCCC
CGCGAGGACGAAGGGAGTCGATACTCCAGACTCAGCACTTCCCCGGGATTTCCCCGCGAG
GACGAAGGGAGTCGATACTCCAGACTCAGCACTTCCCCGGGATTTCCCCGCGAGGACGAA
GGGAGTCGATACTCCAGACTCAGCACTTCCCCGGGATTTCCCCGCGAGGACGAAGGGAGT
CGATACTCCAGACTCAGCACTTCCCCGGGATTTCCCCGCGAGGACGAAGGGAGTCGATAC
TCCAGACTCAGCACTTCCCCGGGATTTCCCCGCGAGGACGAAGGGAGTCGATACTCCAGA
CTCAGCACTTCCCCGGGATTTCCCCGCGAGGAGGAAGGGAGTCGATACTCCAGACTCAGC
ACTTCCCCGGGATTTCCCCGCGAGGAGGAAGGGAGTCGATACTCCAGACTCAGCACTTCC
CCGGGATTTCCCCGCGAGGACGAAGGGAGTCGATACTCCAGACTCAGCACTTCCCCGGGA
TTTCCCCGCGAGGACGAAGGGAGTCGATACTCCAGACTCAGCACTTCCCCGGGATTTCCC
CGCGAGGACGAAGGGAGTCGATACTCCAGACTCAGCACTTCCCCGGGATTTCCCCGCGAG
GACGAAGGGAGTCGATACTCCAGACTCAGCACTTCCCCGGGATTTCCCCGCGAGGAGGAA
GGGAGTCGATACTCCAGACTCAGCACTTCCCCGGGATTTCCCCGCGAGGAGGAAGGGAGT
CGATACTCCAGACTCAGCACTTCCCCGTGA
tttccccgcgaggaggaagggagtcgatactccagactcagcacttccccgggatttccc
cgcgaggaggaagggagtcgatactccagactcagcacttccccgggatttccccgcgag
gaggaagggagtcgatactccagactcagcacttccccgggatttccccgcgaggaggaa

 7.03 PlyA -  52119  52114    6                               1.05
 7.02 Term -  54761  54598  164  0  2  103   53    71 0.563   4.15
 7.01 Init -  55015  54958   58  1  1   81   84    31 0.826   3.86
 7.00 Prom -  55322  55283   40                              -4.76

 8.10 PlyA -  55761  55756    6                               1.05
 8.09 Term -  58358  57533  826  1  1  -27   53   752 0.910  54.03
 8.08 Intr -  60745  60093  653  1  2   29   61   699 0.618  53.45
 8.07 Intr -  61136  60960  177  2  0   -4   59   129 0.393   2.12
 8.06 Intr -  63188  63066  123  2  0   56   18   105 0.376   2.26
 8.05 Intr -  70175  70058  118  1  1   62   72    30 0.279   0.44
 8.04 Intr -  71202  70956  247  1  1  -47   80   336 0.120  17.06
 8.03 Intr -  71433  71211  223  0  1   37   69   175 0.348   9.43
 8.02 Intr -  74524  74426   99  1  0   84  107    49 0.804   7.87
 8.01 Init -  75106  74981  126  1  0  106   60    74 0.664   6.77
 8.00 Prom -  79470  79431   40                              -0.26

 9.01 Init +  81252  81283   32  2  2   94   21    52 0.295  -3.40
ctaagtacagtcagcagcgggggtctctccccgaggagtgagggcggctgggcagtcagg
actttgtactggatctctggataaaaggagcggtccaaggcactggagtgctgtgtttta
tgtttaatgcataaagggagccactgcctgccccaaaccaggtaccttcgaaacatcacg
ATGGCCCTGAGGCTGCACCTAGACCTGAGCAC
gtagcatggaagtcattctggcagtggccgtggtctctgtggaggtctcagcttccgggc
cgccaggcagcccagtacagaagttcatctgtgcagtgcaaaggctcgaggtggaggccg
gggagcagctacgaggcccttcaccccacagggagctgcaggttcatgtctcatgcgtgc

 9.02 Intr +  81581  81684  104  2  2   87   82    88 0.449   9.08
ccggggagcagctacgaggcccttcaccccacagggagctgcaggttcatgtctcatgcg
tgccacacagtgcagggcattcttatggcatgtttaaaactaagaccacacgtgtgtgcc
ccgggggtgaggcgcaagcgtggcctgtgttctaactggcgcttttctttgtctcactag
CCCGTTTTACGGAGAAGACTTTTACTGTGAAATTCCTCGGAGCTTTCGTCACCTGTCCTT
CTACATTTTCGATAGAGACGTTTTCCGGAGGGATTCCATCATAG
gtaggtgatgaatgagcatttacttccccttttctgcctgttctgtaccaggcgagtatt
agcatttcagtccagagcctggctggatggtgctgaggggtcgctgcagggcttgaggtc
acagcagccctgggtgttcctcctgatctgctcttgggatctggcctggcatctgtggtc

 9.03 Intr +  82162  82249   88  2  1   45   95    37 0.422   0.29
ttccccggggcatctgtggggggacctttgcatggatgtggggcctccctcctcaccacg
tcttggctgtccctgtcccaactttagtccccacagtgtgggcacaggaagggcgggtgg
gggtgggggcatgttgcctcagtttccccctggtttttggggcaatactgttacttccag
GAGATGGTGTGTTTGGAGCAGGGGTGGGGCTGCTCTTGGAGAAAGCTCATGGGCAGCCCT
GCCTGGTATCACAGGAAGGCGGCATCCT
gtaagttgtggggcctctgggcagagtggacttcaggttactcggggagctccttgttcc
taaatgcagccagaggaccccgtcaggagcagacctcacgcagcaggcgtgggaggctga
gggatcaggctaattcccgccgtgacgctgggagagccaggaagggaggaggggtcctgt

 9.04 Intr +  83394  83498  105  0  0   54   89    88 0.189   5.99
ccggacatttttgggactgttgttcactgtacccaagtgattattcttagaaactgctgt
gtttttcatagaagtctccagagtttgtttagaaaatacatggaatgggtcacatggatc
tcagataattgacatttgacttcattttgagcgggaacactgtgctgggtgcttccgcag
CGGACACCCTGGCCCTGAAATGCGGCTGCAGAAGGTGTCTGAGTGCAGCGGGCACCTGAC
CCCCCTTCAGGGTCTTGCTGTGCTGGGCTTCATGGAGCCTTGTCG
gtgagatggtcttgagggtccagcgtgacccctgcacccccttgctcagtgtctgcctgg
gaggccctcaggttcaggcccatagctttatgtcgcgttcaagctgggtgctgcggaagg
gttccctcttcctctctccctctgaccagggcatcggctccagggctagtggctggcagt

 9.05 Term +  83958  84147  190  0  1   91   37    33 0.197  -3.61
cctgctgcaggagatggcctccgaccccgcggcatgggtgggctgccctccgtgacctgc
ctcccctgccccactcgttggttgtggttctcttgcctgttgtgctgtgtccactggaca
gagcttcctggagcccatggtcctgcagggcaggcctgtgtctcgctcctgtgttctcag
CCCCTGCCAGGGGCCTCCAAGGGTGTTCTCAGAAGAAAGGGAGGCATGGAATCCAGATTA
TTCAGCGGAGGCTAATGGTGTATCTGGCGGGGCTCAGCCTGTGCCGGGCGCCACGCGCGA
ATTGAGGTGTGACCGTGTGTCAGGCCTCGTCACCAGCTCCGTTTATACTCGAGAATCCAC
AGGGACTTGA
ttcgttctcgaaggtgtatgagacattttttgagcgacaaccctaaggaaaaagaaattt
aaaaaatttttgcacattttagtaagagaagctgatcaagttagttctggagttatatgc
tctgaaaataaccaaataagatgtttattaatcattctgttgacgtcgtctgctagtagt

10.04 PlyA -  84296  84291    6                               1.05
10.03 Term -  84429  84320  110  1  2    2   43   100 0.380  -3.50
10.02 Intr -  84739  84586  154  1  1  118   75    71 0.849   9.64
10.01 Init -  86792  86622  171  2  0   63   95   104 0.572   8.18
10.00 Prom -  87895  87856   40                              -4.46

11.09 PlyA -  88132  88127    6                               1.05
11.08 Term -  90150  89899  252  0  0   60   52   118 0.586   2.04
11.07 Intr -  90938  90856   83  0  2   56   81    28 0.229  -0.59
11.06 Intr -  91539  91422  118  0  1   75  101    14 0.738   2.61
11.05 Intr -  92300  92202   99  2  0  -12   36   139 0.315   0.17
11.04 Intr -  93438  92511  928  2  1    9   49   443 0.187  25.31
11.03 Intr -  94030  93985   46  2  1  133   49    48 0.282   4.00
11.02 Intr -  95440  95304  137  0  2   83   17   106 0.491   4.39
11.01 Init -  96536  96448   89  2  2   61   62    78 0.704   2.72
11.00 Prom -  97658  97619   40                              -1.56

12.03 PlyA -  98518  98513    6                               1.05
12.02 Term -  98925  98632  294  0  0  -11   54   370 0.434  20.03
12.01 Init -  99359  99276   84  2  0   35    7   102 0.279  -4.26
12.00 Prom - 101769 101730   40                              -4.76

13.01 Init + 102597 102650   54  2  0   95   74   -30 0.747  -2.33
atgcacatacagacaggcagacaccgacaggcagacacacacagtttcatgcaaacacag
gcagacacacagccgtgtgcacacagacggacacgcacacacaatcgcacgcccacacag
acacatagccacatgcacagacaggcagacacacacagctgcatgcacacacaggcgaac
ATGCACACAGGTGGACACATACAAGCAGATACACACAATCACATGCACACACAG
gtagacacacagtcgcatgcacacaggtggacacagccacacacagatggacacacagtt
gcacgcacacaggcagacacacagccgcacacacaggcggacacacagctacacaggcag
acacgcacacagcagcacagatggacacacatagtcgcatgcatgcataggcagacacac

13.02 Intr + 103848 103924   77  2  2  127  107   134 0.994  18.66
aggccacagctgggaccctgcgtcccgggggtggagtggaggggctggacgtgcccattg
gccagggcagggcggggccgcctgctccctttgccctctaggctttccctgggcgcgcgg
ccctagtggcctgtgggagcagcgccacagcctctgacaccccatccttgtgccttgcag
GGCAAAGTGCACCTGGAGCTGCGGCTGAGCGAGGTCATCACAGACACTGGGGTCGTCTGC
CACAAGCTCGCCACACG
gtaagacacgtcctcactagagaccgagcgcacagcgagtggcatgtctggctcccgagg
agcacacaggggttttcacaccaacgcacaagaatttccagagccggtggctgcccagga
tgacactgtttagaggtcctggcccaccaggatgatgctgttttaggggtcctggcccac

13.03 Intr + 105808 105909  102  1  0  119    9   116 0.580   7.25
tggccagcgtgattcagcgtcacaccgaggcagaatggctggtgtggccctccctgcctt
ccggtgaggaaacctcatctcacagcttgaactcaggcctcctgcctgacccagagctgt
ctcgccattcgcccaggtgtctgcgctccctcctgacgccgcctctgcttctctcctcag
CATCGTCGAGTGCCAGGGCCTCCCCATCGTGAATGGGCAATGTGACCCCTACGCCACCGT
GACGCTGGCAGGACCCTTCAGGCAAGTTGCCTCACGCTTCAG
gtttctgttctggtcctggggggctagggtccagctctgaaatcacgagaccactgcctc
atttgggaggagtcaggaggttgcgctttgaggtagaatgtgaatttttacttccttttg
ttttctttattgctccaaaattgctttgtagaaaatgaagccttcatgctcttcacgctg

13.04 Intr + 106274 106346   73  2  1   55   73    58 0.584   1.56
tttttggctgagtaaaggttcctgatttgcataccatctggagttggagaccagcagaaa
tatttataaaataaataaagccaataagtgacttgtgcatttgagagctcggttttacca
ctgagagacttggaatcagcagtgttgttttaatcccaatcctttctcacttgataacag
ATCAGAAGCAAAGAAGACGAAAGTGAAGAGGAAGACCAACAATCCCCAGTTCGATGAAGT
GTTTTATTTTGAG
gttggtatcttcatgggtcaacgttaagtggaaactctgcacccgagacacgttggcaga
aagtctggatccagaatgatctcagtctcttccctctggaagttccttccggagaggagc
gagccccgccagccggccctgggttccttccggagaggagcgagccccgccggccggccc

13.05 Intr + 109380 109456   77  2  2   88   94   119 0.933  11.96
aatgctggcactcaggaagccaggcctgaatcccgaatcccgcctggcgccttcctggtt
gtggcccttgagtggtgtgtgggtaagcgcagagggtagggcagcccggggcctaggtcc
gcatatacccccgcctggtggcaccgcggtctcagcgctttctctctcgtctgactccag
GTGACCCGGCCCTGTAGCTACAGCAAGAAGTCCCACTTTGACTTTGAGGAGGAAGACGTG
GACAAGCTCGAAATCAG
gtgagaaaaccaggctccgcgtccccaacttggcagttttcacccaaactcctcagctct
tttgttctttgttactaaatatagggtcatagatagaaatgaatttccattttcttggta
attttcacaacaggatgttagaagttgtagttgaagtgacagcctgtgggtggtgttagg

13.06 Intr + 112227 112331  105  0  0   61   83   153 0.372  12.59
ccaaagccacaggctggtctgacgtgtttgaaacgtgccctgtgggctgagccttgatgg
agactctgggaggcgctgcaggctccattctgctcctgggggaacaaagcgtggcctgtc
atctttgctccacacgggctgcccgccgtcagctagagctgtcctgatgctgtttttcag
AGTTGACCTCTGGAATGCCAGTAACCTGAAGTTTGGAGATGAATTCCTGGGAGAACTAAG
GATCCCGTTGAAAGTCCTGCGGCAGTCCAGCTCCTACGAGGCGTG
gtaagatgatgttgcacctgcagacttccgcatctctgagagccacaaaaacacgtgctg
cctctgagtggaaaggcacagaggccacatgtgctggtcctcggctgtgcccagcaccca
cctgctcttactttgcatgtagctctgacgagctctggcttgatgagtttctgccccaca

13.07 Intr + 112474 112515   42  1  0   62   94    36 0.514   0.09
ttgaaagtcctgcggcagtccagctcctacgaggcgtggtaagatgatgttgcacctgca
gacttccgcatctctgagagccacaaaaacacgtgctgcctctgagtggaaaggcacaga
ggccacatgtgctggtcctcggctgtgcccagcacccacctgctcttactttgcatgtag
CTCTGACGAGCTCTGGCTTGATGAGTTTCTGCCCCACAGCAG
gtgagaaatggcaggtgaggagaggcagcagggatcacactgagcagggactcacaatgg
ctggcacctcaaaacaagacagggaacgtgggtgaaagcggccctaagccacgagcagct
cacggggtctgatcctgggtgaaagtgggaccctgagccgcgagcagctcgcagggtctg

13.08 Intr + 114816 115011  196  0  1  118   35   294 0.738  27.73
cccggtgaccagccctgctgggggtcttcggtggggagtccccaggggctgcactctgag
gggtcctacaggatcaccctcctgaccagtcgacctcaagcaggcagctgggcttccctg
agagctgctccttggcagatgcagcctcatgcctcccctccatgtgtccctcccacccag
GTACTTCCTCCAGCCCCGGGACAATGGTAGCAAGAGCCTAAAGCCAGACGACCTGGGCTC
CCTGCGGCTGAACGTGGTATACACGGAAGACCACGTGTTTTCTTCTGACTATTACAGCCC
TCTGCGGGACCTGCTGTTGAAGTCTGCGGATGTGGAGGTGCTTGTCCACGCCGTGGCCTG
TGGGTGTGGGCAGGAG
gtgccacctgcctggggccccaccctacacccgggcccaccccagagggcaccttctccc
tgagggggcctttcccacgcctcccagcctggcctgtttcccgtccagatgcctggaccc
ctttgctgggggcactggtccgtcgacagttagagccgtgggagcctggtgatgctaagg

13.09 Intr + 115483 115631  149  0  2   95   81   225 0.927  22.72
caagggtccagccaagcagcagcaaatgggaagtttggtgtttttgtgaatgtgtgtgtt
tctgtctcagcaaagagccgtatctattgtggctggaagtgagaccccagccaaggtggg
gacaggcctctggggttcctgcaccccgggccctggcactgacctcacccctccccgcag
CCCGTGTCAGCGTCTGCGGCCCACATCCTGGGCGAGGTTTGCCGGGAGAAGCAGGAGGCG
GCCGTCCCGCTGGTGCGGCTCTTCCTACACTATGGCAGGGTGGTGCCATTCATCAGTGCC
ATCGCCAGCGCGGAGGTGAAGCGGACCCA
gtgagtgcccaccctgccccgggggagagcggcctggacccgctacagggatggcaaggt
cgtcgccgagaaccacgtgtcctggggcagggcttgagggaattcaagggtccccagaaa
ccatgttgattcaggttttctttcacagacccagttaatgattcttttttttttttttga

13.10 Intr + 116351 116498  148  2  1  114   83   261 0.962  29.62
cggttccctctggcagtgttgacacaggacggttccatggccagggcctccaagcacctg
gcctggttgtgctccttgtaaaatgtcaggaagccgactgatgggcgtgcactgacctca
cagcccacaggcaggtgctcggggccaggctctgctccgtctgcacttccgcgtccccag
GAGACAAACGCTGTCCCCATCGCCATTTCCCAGGGACCCCAACACCATCTTCCGAGGAAA
CTCACTGGCGTCCAAGTGCATCGACGAGACCATGAAGCTGGCGGGGATGCATTACCTGCA
TGTCACCCTGAAGCCCGCCATCGAGGAG
gtgagcacggggccgagagtcctcagcctcacgaggcgtggggaggatttcccccaacag
agggcactgcactgggatccagccagaccacgagctgggcttgaatgtcggcccctctgg
cctcgccacggggatgctgattcattcacttttatcaagaggatgttccctgtgtactcc

13.11 Intr + 117464 117538   75  1  0   70   78    72 0.972   5.26
gccctgcagtccggcctcaccgtgcccctccgtgccagtggccgggttcggggagctgtc
gtggcattttctggatgaggctcagggtctacatctcagccaggcctgagaccccttcca
ccctccctgcctgtgcccccagaacccactcacagagccctgtcttaaacctctccccag
ATATGCCAGAGCCACAAACCCTGTGAAATCGACCCTGTGAAGTTGAAAGACGGAGAAAAC
CTTGAAAACAACATG
gtaggttttgttcatgaaccaaccaaagccagtcacctgcttggggtttttcagccgatg
gctgcctggaagctctgactcaccccgtgaccccggttggggtgggagcaggaccaggcg
tggggatacccgcctcacccggctgcagtacgctggctgcactactgggaggcctcagcc

13.12 Intr + 118403 118526  124  1  1   77   96   209 0.987  21.93
attgccacagctcccagcacagatttccagggagtggctgttcacacgtgtctcactgcc
gcagctgccctgcgcccgccctcagcccctccccacgcgcccctccctgggcgtgccctg
gtgctacacgcacctgtgggcagcctcgggagtgggtcccagtgccgtgtcccgttgcag
GAGAACCTACGGCAGTATGTGGACCGCGTCTTCCACGCCATCACTGAGTCTGGGGTGAGC
TGCCCGACCGTCATGTGTGACATCTTCTTCTCCCTCCGGGAGGCGGCGGCCAAGCGCTTC
CAGG
gtgagtgccctgaacaccctcatgttgctgagaaactgccatagcgctgtgcagggtgac
tcccacccaggcagaaccccccgcagccctggctagactagaactgcggggtcgtgaacc
ccagttccgatgctggatttttccggggtttgtgcccgggccagtgttccctagttcaca

13.13 Intr + 120487 120593  107  2  2  125  113    18 0.965   9.10
agagggaaacagagagagggagagagggaaacagagagagggagagagacagacacaggt
ggagatagagccaggactgtggctggacttccctgcggaccctcagggggccggggcatg
gtgtccccacgaggccattgtgcccgaggaaaacggtcaccctgcttctctctcccgcag
ATGACCCGGACGTCAGGTACACTGCAGTGAGCAGCTTCATCTTCCTGAGGTTCTTTGCGC
CCGCCATTCTCTCCCCCAACCTCTTCCAGCTCACGCCGCACCACACG
gtgagtgaccggctgagggaccgaggctttctgagctgtcctgcgacgccggcctgggtt
ggggcatctgcgtggctgtagggggccgaccgtgtggagtgtggaatgcgtggggagtgt
gtgaggaatcaggagtgagtggggagtgtgtgtggaatgaggagtgagtggggagtgtgt

13.14 Intr + 122487 122564   78  2  0  114   65    91 0.990  10.30
tgagactgtgggacgcccaccccctccagtcccatctgcgtcgctacccctgtttctccg
tagctcatgcacaagccacagcagctctgaggtgactcctgcatttcgtcccctcgatct
gggacagtcacagcatttctgtgatgctgacatagacctttcttgctcccgcctccccag
GACCCCCAGACGTCCAGGACGCTGACATTGATCTCCAAGACCGTTCAGACCCTCGGCAGC
CTGTCCAAGTCCAAATCT
gtgagtccctcttcttcattttctctttttagggacaactgattcttttctctcttcaga
aaatacacgtgaaaaacctcccacatttgagagagtcgtaagataaagatcaagaatcaa
agccggcaccacatcctctcttgaaacccaggacctgagcgtccccgtcccgctcacctc

13.15 Intr + 124271 124348   78  1  0   78  111   109 0.804  13.10
cgatttatgtgattcgtcctccgggcagccctgcgggctctcacttgcccggtaacaccg
ggttctttgcctgtttatcgtcatttaggcttggacagttcttgcctctagctttttcag
atttgggccgtgagccgaggtacttcgggctgtcctcgagtgatctccgtttcattttag
GCGAGTTTTAAGGAGTCCTACATGGCTACATTTTATGAATTCTTCAATGAGCAGAAATAT
GCTGATGCGGTGAAGAAC
gtaagtatcgactcaccctccgaccgcccgtgtgccgtgctcaggagacggagttctctt
ttaaaattgagatagaacccacatgacacagacttggccattagcgattttaaacaataa
aggcgttcggtgcattcacagcgctgtccagacagccttgtcccaagtcctgggacacct

13.16 Intr + 125804 125896   93  1  0   78   41    56 0.020   1.22
cagtcaggaacgcggtgcgtgggggcaacctccaggccccagggctctgctcctccccac
agtcaggaacgcggtgcgtggggggaatatccaggccccagggctctgctcctccccaca
gtcaggaacgcggtgcgtgggggcaacctccaggccccagggctctgctcctccccacag
TCAGGGATGCCTGAGCCTCCTCACTACCGGGACCCAGATTCCCTGCTTAGAGTCACCCCT
GGGTGGCCTCTGGAGATGCAGGTTGATCCCCAG
gtgttgcctgagcccggcctctcacctgagatctctgtggcagtgccggggctggggtgg
cacagtggggagcagaggccccacagccctcggggaaggactcacttgcccagattctgt
ctccactggtattacaaaggaggcagtagccgccgacgctgttgttatacagagagccgt

13.17 Intr + 126129 126202   74  2  2   81   86    88 0.028   7.25
tggggtggcacagtggggagcagaggccccacagccctcggggaaggactcacttgccca
gattctgtctccactggtattacaaaggaggcagtagccgccgacgctgttgttatacag
agagccgtgcacgtcagatgtgtggcttcctcccggtgacctgatttcttccaactttag
TTCTTGGATCTGATTTCGTCCTCGGGGAGAAGAGACCCCAAGAGTGTTGAGCAGCCCATC
GTGCTTAAAGAAGG
gtaaggagggtaaggtggcgtctggcagggcaggaggggagaagggtaaggtggtgtcca
gcagggcaggaggggagaagggtaaggtggtgtccggcagggcaggaggggagaagggta
aggtggcgtccagcagggcaggaggggagaagggtaaggtggcgtccggcagggcaggag

13.18 Intr + 131420 131528  109  2  1   96   92    42 0.064   6.85
aacccccgtctgtgtaggccccgccctgcgcatcccactgggtcctgctggtcctcaaca
gcctcctgggctgacttcctgcctgtgaatccctggaatgaacggcgttcggcatccact
ggttgtgaactgcgctgtcctggcggctcccagcgccccgcccttttctctcttgaacag
CTCCCAGCAGCTTCCACACCCTCCGGTGTGCGTCCACAGCTCTCTGGCCACATCTGGCTG
TGTTGCTGCTCAAAGCCCCTCTTTCCGATTTCTGAGTGCGCTTGTCGAG
gtgcgtctcccccgcccacctccccactctgtctctccagcttggcttctcgtcctcagc
ttccacctctgtcctccagtcactctgtctggccactttcttctcctccagctcggccgc
cggttctggtcagggacccctgcccggcaatgaaggccgagcctcagagggccctgggct

13.19 Intr + 131569 131656   88  0  1  112   41     7 0.364  -0.90
ccagcgccccgcccttttctctcttgaacagctcccagcagcttccacaccctccggtgt
gcgtccacagctctctggccacatctggctgtgttgctgctcaaagcccctctttccgat
ttctgagtgcgcttgtcgaggtgcgtctcccccgcccacctccccactctgtctctccag
CTTGGCTTCTCGTCCTCAGCTTCCACCTCTGTCCTCCAGTCACTCTGTCTGGCCACTTTC
TTCTCCTCCAGCTCGGCCGCCGGTTCTG
gtcagggacccctgcccggcaatgaaggccgagcctcagagggccctgggctgccgggag
ggtgttcgaggaccctgcccagggcaaggcttgaggtcctcctcgctgaggccttgcatc
ctcggtggccatcctgtctcctgctccccacgtttcctgaggacgtggcccagtggcgcc

13.20 Intr + 131917 132037  121  2  1   43   30    82 0.295  -1.37
agggcaaggcttgaggtcctcctcgctgaggccttgcatcctcggtggccatcctgtctc
ctgctccccacgtttcctgaggacgtggcccagtggcgccttctaccacagcagggctgg
ccctgagggggcaggtttggtctggcagaggcgctggtgcgtgactcccgcacaacacag
GTGTGGGTTTTGTGGGCGTCTGCTGCCTGCCCCGGCCCCAAGCCTGTGGCTGCAGGTCCT
CTGAGTATGGGCGTCTGCTGCCCGCTCTGACCCCGAGCCCGCGGCCGCAGGTCCTCCGTG
T
gtgagcgtccgctgcctgccctgaccccgagcccacggccgcaggtcctccgtgttgtgt
gggcatccactgcccgccctgaccccgagcctgtggccgtaggtcctctgtgttgtgtgg
gcatccactgtccgccctgaccctgagcccgcggctgtaggtcctctgtgtgtgagcgtc

13.21 Intr + 132803 132909  107  2  2   88  116    41 0.850   7.92
tttcaaaggagaggcattgccttccaattttaatctcatcactcggagtaaaatgataag
atattgaaaatccactgcctgcctcaggtctcagaacgcagaaagtggggggtgtggttt
ttcacctgtgcagggaggcagctgaggcccggaccccggccctgtgtgctcttcacacag
GTTCATGATCAAGAGGGCCCAAGGACGGAAGCGCTTTGGGATGAAGAATTTTAAGAAGAG
ATGGTTTCGCTTGACCAACCATGAATTTACCTACCACAAAAGCAAAG
gtaaggagcaaggtcgctttccctggctcttgctggagcgtgctgggccctgggactgag
tctgctttttcagggggagagctgaggggaggaaggattcagtgctgcgggcagagcccg
gggccgcggtgacccagagccctctgcttctggttctcccttcaaagatccctgaagggg

13.22 Intr + 134068 134150   83  2  2   82   92   110 0.873  11.31
ccccggtagagaccccctggcagagaccccctggcagagaccccccggtagagaccccct
ggcagagaccccccggtaaagaccccctgggagaccccccggcagagacccctcagcccc
acccggaccccagccgggacagcggggcccgcacccactgacagtccatctctgctgcag
GGGACCAGCCTCTCTACAGCATTCCCATCGAGAACATCCTGGCAGTGGAGAAGCTGGAGG
AGGAGTCTTTCAAAATGAAAAAC
gtgagtgtggggcccccaagcctctctttcgggttgaggcctggccaggttttctctgct
ctcttcccgtacctggccctgggctcacccttccccacccactgcactccaggcttctca
gagtcttcgtgttactcgggttgttcaccaggtgctggtgagtttgtgtcggaatctcgc

13.23 Intr + 134263 134307   45  0  0   87  105    25 0.723   3.84
acagcattcccatcgagaacatcctggcagtggagaagctggaggaggagtctttcaaaa
tgaaaaacgtgagtgtggggcccccaagcctctctttcgggttgaggcctggccaggttt
tctctgctctcttcccgtacctggccctgggctcacccttccccacccactgcactccag
GCTTCTCAGAGTCTTCGTGTTACTCGGGTTGTTCACCAGGTGCTG
gtgagtttgtgtcggaatctcgcatcaaagcagccacactctctgtgcccggggtcaccg
gggtggggtggaacctgccggaaggtggggcctgagctgcttcaggtggcgtcccccgca
gggtccccaatgtcaaggggccctctgtcaaagacatcccagaagcaggcttgggaccgt

13.24 Intr + 136996 137204  209  0  2   78   69   300 0.673  26.19
ccatgcaccccctggccttggcctcttctggggcttagagctccaggacttttgggcctg
tgcaccctcagcgtcccctcttacgactccggcgaggacggccaggtgcctggtggactc
ttgcacgtgctcagccacgagacctcatgtgcgctgtcctgagcccacctgtgtcctcag
ATGTTCCAGGTCATCCAGCCAGAGCGTGCGCTGTACATCCAGGCCAACAACTGCGTGGAG
GCCAAGGACTGGATCGACATTCTCACCAAAGTGAGCCAGTGCAACCAGAAGCGCCTCACC
GTCTACCACCCGTCCGCCTACCTGAGCGGCCACTGGCTGTGCTGTAGGGCGCCATCCGAC
TCGGCTCCGGGCTGCTCGCCCTGCACTGG
gtaggtctgtgcctcggtgcccagctcgtgcactgtgcaggaaatgtggccaaggggctg
agtagggagggaccagcagacagtgcatgcctgcctgtaagctgcacataaacagggctg
ccctcgcctcctcccaggagcctcccacccgaggggtcctccctcgagggagcatctggg

13.25 Intr + 141147 141250  104  0  2   58   96   153 0.880  14.08
ccttgctcagcaagccaacacaccggctgtgcacagacggacagcaaatcgatcctgtcg
aatttcacttccaacacaatcgttgtctttcttcagtgacattttaaaaatgaatgtcat
tattaaaagcatcgtttaaataagtgtttttatctttctgttcttgctgtgtctggacag
CGGCCTCCCAGCCAACATCCAGCTGGACATTGATGGGGACCGTGAGACGGAGCGTATCTA
CTCCCTCTTCAACTTGTACATGAGCAAGCTGGAGAAGATGCAGG
gtgagtctgcccggcacacagatctgtgcagcgaggggatggctggcgaggccccggcct
caggagcatgctgtggggtgaaaacctgtggtctgagcctctggtgtagtgtgggctaca
tgtagttgtctttgtagcacggatggatgcgaaaagctttttgcagggtaggcagctatc

13.26 Intr + 143081 143249  169  0  1   91   72    34 0.388   2.30
atgaacatacaggtacatgtgtgtgcagacaggcaaggcaacaatacctgcacacatgtg
cagttgaacacaacacgctcacatgtgcaggcccatgtgcaggcatgcacacacatgtgc
agacaaccacacatgtacacactcatgggccaccacccaccacagcgtcttctcccccag
CAAGTGTGCGAGGTGCTGTCCCTGGGTCTGAGGTCCCTGGATACTGTGAAGATGGCACAA
GGCCTCAGGGTGGCCAAGACAGTGGGTCTGGCATCAGCCAGCCTCTTCCCAGCCCTCTCA
TAGCAGGAACCGACACAGCAGAGGCCAGAGTCAGGGAGCCTCGGAGAGG
gtgaggtcatcacacacaagacccaggttctgaaagatgctgaccaggccctccatgatc
agcttgctccctgcaccactgtccaaccttgctcagctcctcctaggccgtgcgccccgc
atcacagctccagctcttcctctgctgggaacacccttgcgcatcaggctggcagaccct

13.27 Intr + 146663 146793  131  2  2   54   97    47 0.267   3.72
cgaggatggctttttctccacggtccagtagcatggccgtcctttctgtctgagatgttg
ttagaacagccttgccacccatgctcatgccaccattctgttcagggttacttagatatc
ccctaagacaggacttctctgcagctctcctctcccgagcccccagcattgtcctttaag
GACATTCATGGCAGCCATGCCTTTTCCGCTCTGCACCCCCAAACCCCTTCAGCCTTCGCC
CAGCACCCAGTTCCAAAGCCAGTCCACATTTGAAGGTACAGCAGCAGCCACTTCTCAGTA
CCAAGTTCTTG
gtgagtttgggctgccgtaaaaattgtaccataggctgggtggttacagacagcaggaat
tcacttcccagattgaaggcctgagaagcttgagatccgggcgtagcagtgctggtttaa
ctgcgggtcctcttctgggctgcagcccgccagtgtctcattgtgtcctcacatgtggaa

13.28 Intr + 147942 148125  184  1  1  105   81   343 0.996  35.35
cctacctgcgggaatggtttctatctccgtctgcgtttacgagtggtggtcagccctttc
tggaggagcttgcgttggaaggatgtgtactgtgggtggggcctgcagcgacgcagctgt
gtggagacggggccggtggcctgggctcctgccctgcgctgacccctccgccctccacag
AGGCCTGTGGGAGCAAATCTGTGTATGACGGCCCGGAGCAGGAGGAGTATTCGACGTTCG
TCATTGACGACCCCCAGGAGACCTACAAGACGCTAAAGCAAGTCATCGCTGGGGTTGGGG
CTTTGGAGCAGGAGCACGCCCAGTATAAGAGGGACAAGTTCAAGAAGACGAAATATGGAA
GCCA
gtgagtgccactcccgtgcctgccctggacggccagtgtagtgggcgggagattgcagtg
ggggtggggctgcagggagctcccgggtggggccgcccgtgctcaggtgtccgcctggga
ggagagtcccacttgcaccgggctggcacctggcggtagtcagtggacgtggcccggcgc

13.29 Term + 150378 150453   76  0  1  130   39   135 0.995  11.02
acacatcagagtcaccgtgggtgcttccgggggcactgtggttcctttggctcctctatt
ttttgtgtggattgcagtgtgagtgtgtcacatttaggaacaggaaaagctcccgcagcc
acgggtgagcaccaggcaacggggtctgtgcctcattccctctcccatcccccttttcag
GGAGCACCCCATCGGAGACAAGAGCTTCCAGAACTACATCCGGCAGCAGTCCGAGACCTC
CACTCATTCCATTTAA
agtctgcgggacgcgcccagtggcgccagcaagctgcccatgcaaagccgcagcctttgg
gagggagaagagaaggaagagcgcagagccggcaaagtgagatgcacgccgtcccggccc
atagacaagtggcgctggggtttccctctcccagaaccgctgccaccaccgccacgccct

Predicted peptide sequence(s):


>RASA3_1|GENSCAN_predicted_peptide_1|118_aa
MAVEDEGLRVFQSVKIKIDPCWGPRRRRPPGAARSPENGWSGSAAPPHLPASPGLGLGRV
GSGVTRLPAPPLRPERPRSLVAAEEPRLLGSASESEECEKHWASSVTGAGGLELLQVR

>RASA3_1|GENSCAN_predicted_peptide_2|364_aa
METLLLPAWLWGQHFAPGASEEGGRKHVSCTVTTGRRGGRPSRGHGLRLVLRLPEQWLLW
GRENTEVTRSRQTSCSSTSRVWNQNKKSPELKRRVKPFPSEGTQLKRRFRGARKGPQTPA
LTRGCVRRDALSELPPRPPPQFHNGCPTSHPPEVPAPAAQPRTLQRYRHLLPNLAPSRGT
GTCCPTSHPPERYRHLLPNLAPSRGTGTCCPTSHPPEVPAPAVQPRTLQRYRHLLSNLAP
SRGTGTCCPTSHPPEGQVQSYPSQTPSKMTAKTKATSLFRSKLKAIPPRHPDDSQNQKQK
PPLQSWVRYVHVSPEGPQELSSSPSPSHHRSAAFTFKTLAAITLLVAVSSQYVHLLSKHT
HVYV

>RASA3_1|GENSCAN_predicted_peptide_3|304_aa
MPMRKPEGTNATRECKTVAIRDWLAHIVSTNPPTTASDVRTAHTASINPPTTASDVRTAH
TASISPPTMASDVRTAHTASISPPTMASDVRTAHTASISPPTMASDVRTAHTASISPPTM
ASDVRTAHTASISPPTMASDVRTAHTASISPPTMASDVRTAHTASISPPTMASDVRTAHT
ASISPPTMASDVRIAHTASINPPTTASVCDVCSVCDVCSICNVHAALTMSINPPHHASIM
SSGNMFTVPVPPCGSSFPECLLAGTAGLKKKPKRSVNGTCAQRRLQLRRVTFWGPWEVVI
TLLT

>RASA3_1|GENSCAN_predicted_peptide_4|249_aa
MAVSIQPRSADSVQAPALTLGTLTLTGGQACVSHVRVLVFAGDVAWALRDPLNTTKNLSP
TPGHWPFRNNVAPLNQSQGRSNLTQRVFPKQQNWQQHRHPAVQSTACSVQVSEGEAAVGS
RRTVAGQAQLHDPWPYTGQVLRTRPPPSLHGFSGKQQAAVAQRHDTHITAAFTRSASRVP
TARTGASEHQDTPIRTPAGPVERDRQPQLCRGAACLEHFTRVPGDAGAAAKVPRLPASTP
RGAAGYTNI

>RASA3_1|GENSCAN_predicted_peptide_5|945_aa
MGPPPLSCPTFQWKGFRDFPIWCEVVSQISVERFLSFPHSEDATLGGTGVPGGGALQVAL
AASVCWEGGALWVAWVASVCRKRGALQVALAASHSTALQHPPNEALTLQPGSGAPTSNVR
LCPGRSRCSLGQESSYMKQQSQNGSARPQRLPSFSSSQSILQNGSPLQGHTVARDADAET
GADVQAQAGCQHREAQVDPRAKTPSLGAAGEHGTWLKTQHTGLQRAACGQQLISDEPGPA
KTAGKKIKREAMPSTLGAELRGQRTGGQGNRDPAAQEKEAAQSGPAGQKAATPTDAGPQQ
SGPGHPSPPDHSSRGPATRAPQTTAVGARPPEPPRPQQSGPGHPSPPDHSSRGPATRAPQ
TTAVGARPPEPPRPQQSGPGHPSPPDHPSFSQGQNSSEVPLRCAPRLAGSLFWKPPPRQV
QQPALAVGKKAADVASMENARKHIPHQDTWANSLNSENPRLSEAAMLSAKDTHVGSSGAA
GPRGRNAAVAVVEVAVANGRDCCCVWQRSQLSPLQSTENTKSPRHTLHPKGRSGGSQTGD
GGTGDTEPSRRGAPDTGARVSAQHHHPRCVHTATATDTHPRCVHAATATDTHPRCVHTAA
DHRHPPLMRSHCPRPQTPTPDDTGARVSAQHHHPRCVHTATATDTHPRCVHAATATDTHP
RCVHTAADHRHPPLMRSHCPRPQTPTPDASTLPRPRTPTPDASTLPQPRTPTPDAHPPLM
RSHCPRPQTPTPDASMLPRPRTPTPDASTLSRPRTPTPDASTLPRPRTPTPDASTLPWPQ
TPTPDASTLPRPRTPTPDASTLPRPRTPTPDASTLSPATDTHPRCVHTAAGHGHPPPMRP
HCPSHRHPLVMRPEMPPHPGQRLSPQPIPHDLYPQNLQLARTGLCLTLSSGAGTPVAGTP
SAITGRASDALLVGRPQSLSSATPWRTTAKSLNRTRFGVSMAPSE

>RASA3_1|GENSCAN_predicted_peptide_6|824_aa
MRFRYVGQAGLQLLGSSHPSASASQNSGIKGKSHRARLIIRFKVFGRKCCSQNQAEEGSR
YSRLSTSPGFPREDEGSRYSRLSTSPGFPREDEGSRYSRLSTSPGFPREEEGSRYSRLST
SPGFPREEEGSRYSRLSTSPGFPREEEGSRYSRLSTSPGFPREEEGSRYSRLSTSPGFPR
EDEGSRYSRLSTSPGFPREEEGSRYSRLSTSPGFPREDEGSRYSRLSTSPGFPREDEGSR
YSRLSTSPGFPREDEGSRYSRLSTSPGFPREDEGSRYSRLSTSPGFPREDEGSRYSRLST
SPGFPREDEGSRYSRLSTSPGFPREDEGSRYSRLSTSPGFPREDEGSRYSRLSTSPGFPR
EDEGSRYSRLSTSPGFPREDEGSRYSRLSTSPGFPREDEGSRYSRLSTSPGFPREDEGSR
YSRLSTSPGFPREDEGSRYSRLSTSPGFPREDEGSRYSRLSTSPGFPREDEGSRYSRLST
SPGFPREDEGSRYSRLSTSPGFPREEEGSRYSRLSTSPGFPREEEGSRYSRLSTSPGFPR
EDEGSRYSRLSTSPGFPREDEGSRYSRLSTSPGFPREDEGSRYSRLSTSPGFPREDEGSR
YSRLSTSPGFPREDEGSRYSRLSTSPGFPREDEGSRYSRLSTSPGFPREDEGSRYSRLST
SPGFPREDEGSRYSRLSTSPGFPREEEGSRYSRLSTSPGFPREEEGSRYSRLSTSPGFPR
EDEGSRYSRLSTSPGFPREDEGSRYSRLSTSPGFPREDEGSRYSRLSTSPGFPREDEGSR
YSRLSTSPGFPREEEGSRYSRLSTSPGFPREEEGSRYSRLSTSP

>RASA3_1|GENSCAN_predicted_peptide_7|73_aa
MTPTPTAALLGHGGKLHPQGILGRALRRGWPHVLLNTAAGVSQALSSSAQRPVKRAEEGM
KAATGEDEGPGLH

>RASA3_1|GENSCAN_predicted_peptide_8|863_aa
MPVLACPTMPFPGPAPRRTGHGHPGLCRPAVPRDQVLLLWTQSTVPPGGAAVRPSCIFTA
QSPGAAAPPNLIQALQKFIEGGLALYKENQTHRDGCDQRDSNKGREVEMRIQTHNLCKGQ
VATAATENRLAVPPTFNTQSPRDTVVPPPAIDITAHVRTQTRTRVLTAHVRTQTQTRVLT
AHVRMQTRTRVLTAHVRMQTRTRVLTAHVRTQTQTCVLTASVMTARQWKQGRPWATFQRA
DKTLGSDGTCVRGQQCQVPLPCARCVVGAAGGRPARTALQMDRAASVHTKRRQCYTWAGL
PASTLNGSTVLHHSCESTQGDRRLHALPGQREHLANTSSHPRTTKDRSSAACTPEPQGAS
PPQTKQEENGKKNSLHAGKWDGDVHARDIVYTQKNSLHAGKWDSDVHAQDILYTWENGTV
MYMLGTLSTHRKIPYTQENGTVTYTLGTLSTHRKIPYTRENGTVMYTLGTLSTHRKIPYT
WENGTVMYMLGTLSTHRKIPYTRENGTVTYTLGTLSTHRKIPYTWENGTVMYMLGTLSTH
RKIPYTQENGTVTYTLGTLSTHRKIPYMRENGMVTYTLGTFSTHGKMGRLFIHNINLRHC
EKEQKPQGLDNASRVRAAYLCVWRHRQDEASRVGAAYLWVWRRRQDEASRVRAAYLCVWR
RRQDEASRVRTAYLCVWRRRQDEASRVRTAYLCVWRRRQDEAARVGAAYLWVWRRRQDEA
SRVRAAYLCVWRRRQDEASRVGAAYLYVWRRRQDEASRVRAAYLCVWRRRQDEASRVGAA
YLWVWRRRQDEASRVGAAYLCVWRRRQAFPAAPAAAHTEQLSGSHCLRPFPASAPNTQST
SLGLKVLNCKSKRHSSSRRLLRL

>RASA3_1|GENSCAN_predicted_peptide_9|172_aa
MALRLHLDLSTPFYGEDFYCEIPRSFRHLSFYIFDRDVFRRDSIIGDGVFGAGVGLLLEK
AHGQPCLVSQEGGILGHPGPEMRLQKVSECSGHLTPLQGLAVLGFMEPCRPCQGPPRVFS
EEREAWNPDYSAEANGVSGGAQPVPGATRELRCDRVSGLVTSSVYTRESTGT

>RASA3_1|GENSCAN_predicted_peptide_10|144_aa
MELNVNAESTCFPGENRHNRGIGKTFLDMTPQVQIIQEKNVINWTIEIKNFCSSKPMAED
ALPSPTHTPDPIGMHPHFLLAPASAPLTPGPELATEHSCGCPKGNLLADKSLPEIQTATH
FHSCESHSETSKSSHHNRKATKNY

>RASA3_1|GENSCAN_predicted_peptide_11|583_aa
MQRLSPDRHGGYTIYPVMKLHRLSQQPIGSTWETPPFCRDAKVRGSSTLGPLCSGDARTV
ISSAVITASFTFHSTCKPGAAVAGQLGTVRPDRAHSEHKRANTHNPKSMAETALTPSTSG
RTRTTQNPWQRPRSLRAQAGEHAQPKIHGRDRAHSEHKRANTHNPKSMAEPALTPSTSGR
TRTTQNPWRSPRSLRAQAGEHAQPKIHGRACAHSEHKQANTHNPKSTRGARAHSEHKRAN
MHNPKSMAEPALTPSTSRRTRTTQNPWRSPRSLRAQVGEHAICSSLFPVKAEARSTSLAT
VGAGPVSKPHGVPGLWFPGLRRESHLHFRVSVHVLQLEPGVPVVVLLQVLLLDGHLPCNT
SREDFTTGTGPRARTPVSRSQPIITAAYFQQFNSEWGTGRAFQRLRCEGANVRSIGNVRL
TFTVVRGQFSQQEDRACQALGTEPSPILRPFMAPPCQPCQWPPHTADHATHHASVNSGTL
HCQPLTGAISVGPAVTLEEQTYTGHLELHGTLKPPLRAGESQIKNQGGRHRKQAPAHVGE
GTPGRLREKSSDTPRGLPPMASNGADHEGGRQPGHLRLAHLTR

>RASA3_1|GENSCAN_predicted_peptide_12|125_aa
MWGVLVPSSRLCGPRVLSRPLAAGCAAPWDEAGAVLGVEGNLECRPHRLEQKGDLNADLS
LEQKGDLNADLSLEQKGDLNADLSLEQKGELNADLSLEQKGDLNADLSLEQKGDLNADLS
LELGD

>RASA3_1|GENSCAN_predicted_peptide_13|1025_aa
MHTGGHIQADTHNHMHTQGKVHLELRLSEVITDTGVVCHKLATRIVECQGLPIVNGQCDP
YATVTLAGPFRQVASRFRSEAKKTKVKRKTNNPQFDEVFYFEVTRPCSYSKKSHFDFEEE
DVDKLEIRVDLWNASNLKFGDEFLGELRIPLKVLRQSSSYEACSDELWLDEFLPHSRYFL
QPRDNGSKSLKPDDLGSLRLNVVYTEDHVFSSDYYSPLRDLLLKSADVEVLVHAVACGCG
QEPVSASAAHILGEVCREKQEAAVPLVRLFLHYGRVVPFISAIASAEVKRTQRQTLSPSP
FPRDPNTIFRGNSLASKCIDETMKLAGMHYLHVTLKPAIEEICQSHKPCEIDPVKLKDGE
NLENNMENLRQYVDRVFHAITESGVSCPTVMCDIFFSLREAAAKRFQDDPDVRYTAVSSF
IFLRFFAPAILSPNLFQLTPHHTDPQTSRTLTLISKTVQTLGSLSKSKSASFKESYMATF
YEFFNEQKYADAVKNSGMPEPPHYRDPDSLLRVTPGWPLEMQVDPQFLDLISSSGRRDPK
SVEQPIVLKEGSQQLPHPPVCVHSSLATSGCVAAQSPSFRFLSALVELGFSSSASTSVLQ
SLCLATFFSSSSAAGSGVGFVGVCCLPRPQACGCRSSEYGRLLPALTPSPRPQVLRVFMI
KRAQGRKRFGMKNFKKRWFRLTNHEFTYHKSKGDQPLYSIPIENILAVEKLEEESFKMKN
ASQSLRVTRVVHQVLMFQVIQPERALYIQANNCVEAKDWIDILTKVSQCNQKRLTVYHPS
AYLSGHWLCCRAPSDSAPGCSPCTGGLPANIQLDIDGDRETERIYSLFNLYMSKLEKMQA
SVRGAVPGSEVPGYCEDGTRPQGGQDSGSGISQPLPSPLIAGTDTAEARVREPRRGTFMA
AMPFPLCTPKPLQPSPSTQFQSQSTFEGTAAATSQYQVLEACGSKSVYDGPEQEEYSTFV
IDDPQETYKTLKQVIAGVGALEQEHAQYKRDKFKKTKYGSQEHPIGDKSFQNYIRQQSET
STHSI