GENSCAN 1.0	Date run: 15-Jan-104	Time: 05:36:01

Sequence RAP2A_1 : 36168 bp : 37.05% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1261   1326   66  0  0   61   40   164 0.683   8.03
cggcggcggcggcggcggcggcgggcggggatctgggcgtggaggcgcgaggggcggggc
gggcggcactgcgggcccgcggctcgggcggcaccagcggctcccggtctctctctctgc
tcgccctcagtcccacccggtgcctacggggccgcatcgccgcccggctcggcccggccc
ATGCCCAGGGCCGCTGCTCCCTCAGTTGCCGCCGCCGCCGCCGGCGCCCAGGGGGCCGCC
GCGGCT
gtgaggtgggggcggcagcgggaggcggcggggcgggccgccggggccggggctgggggc
gcagcgcggccggcgtaggtctatgtcgcgggcggcggcggcggcggcggccgcggaggg
acgatgcgcgagtacaaagtggtggtgctgggctcgggcggggtaggcaaatccgccctg

 1.02 Intr +   1405   1763  359  0  2  -14   89   716 0.232  54.63
tacggggccgcatcgccgcccggctcggcccggcccatgcccagggccgctgctccctca
gttgccgccgccgccgccggcgcccagggggccgccgcggctgtgaggtgggggcggcag
cgggaggcggcggggcgggccgccggggccggggctgggggcgcagcgcggccggcgtag
GTCTATGTCGCGGGCGGCGGCGGCGGCGGCGGCCGCGGAGGGACGATGCGCGAGTACAAA
GTGGTGGTGCTGGGCTCGGGCGGGGTAGGCAAATCCGCCCTGACCGTGCAGTTCGTGACC
GGCACCTTCATCGAGAAATACGACCCCACCATCGAGGACTTCTACCGCAAGGAGATCGAG
GTGGATTCGTCGCCGTCGGTGCTGGAGATCCTGGACACGGCGGGCACCGAGCAGTTCGCG
TCCATGCGGGACCTGTACATCAAGAACGGCCAGGGCTTCATCCTCGTCTACAGCCTCGTC
AACCAGCAGAGCTTCCAGGACATCAAGCCCATGCGGGACCAGATCATCCGCGTGAAGCG
gtgagcgagggcacacgggggcttggcggctgcaccccggagtcaccgtcccggggctgg
aactccccgcgcggggctccggggaaggggctttctggggggtggctccaagctggaggc
tttactattgtcattctgctcctcctcctcaatctcaaatttgagtgctttgtttcacaa

 1.03 Term +  31184  31421  238  2  1   97   39   297 0.954  20.36
tgtgagagcagcttcaaatgccctcagatctaagtatcaagccaagtggtacaaatcatt
ttcatgcaactgaagataccatttatgttggaatagcccccaaaaacgaaaatacacgtg
acctgtttaactttgtgctaactgttacaatgtatgtgtgttttgtttattctctcatag
GTATGAGAAAGTGCCAGTCATCTTGGTTGGGAACAAAGTGGACCTGGAAAGTGAGAGAGA
AGTATCGTCCAGCGAAGGCAGAGCCCTTGCTGAAGAGTGGGGCTGCCCCTTTATGGAAAC
TTCCGCTAAGAGTAAAACAATGGTGGACGAACTCTTTGCAGAAATTGTGAGGCAGATGAA
CTATGCTGCTCAGCCTGACAAAGATGACCCATGCTGTTCTGCATGTAACATACAATAG
catccaaatatggctgtcctggatgggatttgcccaatgtcgtaggtgatagaaaactcg
cctactccactgcagaacttgcagaatgcgtggtgttaatctacagagaactgcagccct
tattcagaattgagcagtgattgtcagttgatatctctgagtaacatttgggttcagtaa

Predicted peptide sequence(s):


>RAP2A_1|GENSCAN_predicted_peptide_1|220_aa
MPRAAAPSVAAAAAGAQGAAAAVYVAGGGGGGGRGGTMREYKVVVLGSGGVGKSALTVQF
VTGTFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDLYIKNGQGFILVYS
LVNQQSFQDIKPMRDQIIRVKRYEKVPVILVGNKVDLESEREVSSSEGRALAEEWGCPFM
ETSAKSKTMVDELFAEIVRQMNYAAQPDKDDPCCSACNIQ