GENSCAN 1.0	Date run: 15-Jan-104	Time: 05:43:30

Sequence IRS2_1 : 6370 bp : 70.55% C+G : Isochore 4 (57 - 100 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +    648    828  181  2  1   62   66   165 0.411  12.34
ggcccggggagaaaggggggcggggcgggggcgcgcggcccgcccccgcgagcgccgcgc
cgattggccgagcgcgccgtccgtcggggggcgcggcgccaatgcgaggcagcggggcgg
ggcggccgcgctgtgtgtgcctgcgtaacgccgagtcacatgttgttttgctcttcttag
TTCAGTCACTCGGTGCGCGATGTGTTACTCACTGTGCGGCGGGGACCGCGACGAGCCCGG
GTCGCCGTTGGCAGCAGCAGCAGCAACACCAGCAGCAGCAGCAGCCCCGGCGGCGGCGCG
GACCCCGAGCGCCCGGGCGCACCCCGGCTTCCCGGAGCGCGACGCGGCGGCAGCAGCCCC
G
gtgcggccgcgcgcgccttaggctcggccccgcggctcggggaccccgactcccggccca
gcgagcgcgtcccccggcgccgcccgagagcccgaggaggcagcggccgcaggcagccgg
ggaggggggcggccaccgcccgcgccgggcatcctcaggagccccagagcgcggagggcg

 1.02 Intr +    890   5212 4323  0  0   32  100  6216 0.403 607.93
cgccgttggcagcagcagcagcaacaccagcagcagcagcagccccggcggcggcgcgga
ccccgagcgcccgggcgcaccccggcttcccggagcgcgacgcggcggcagcagccccgg
tgcggccgcgcgcgccttaggctcggccccgcggctcggggaccccgactcccggcccag
CGAGCGCGTCCCCCGGCGCCGCCCGAGAGCCCGAGGAGGCAGCGGCCGCAGGCAGCCGGG
GAGGGGGGCGGCCACCGCCCGCGCCGGGCATCCTCAGGAGCCCCAGAGCGCGGAGGGCGC
GGCGCCGCCGAGCGGTGCTGGCCCCCGCGGGCCTCCCCGGACCTTCCCCACCGCCTGGGC
CCGAGGGACGCGTGATCGGGCGGGCGGCCGGGCGCAAGGGTGGGAGGGAGCCGCCCCCGC
CCGCGCCCCCTCCGCCCCTCGCCCCAACCCCTGGGCGCCGGGCCCGGGCCGCGCGGCCTG
AAGCGCCCGCGATGGCGAGCCCGCCGCGGCACGGGCCGCCCGGGCCGGCGAGCGGAGACG
GCCCCAACCTCAACAACAACAACAACAACAACAACCACAGCGTGCGCAAGTGCGGCTACC
TGCGCAAGCAGAAGCATGGCCACAAGCGCTTCTTCGTGCTGCGCGGACCCGGCGCGGGCG
GCGACGAGGCGACGGCGGGCGGGGGGTCGGCGCCGCAACCGCCGCGGCTCGAGTACTACG
AGAGCGAGAAAAAGTGGCGGAGCAAGGCAGGCGCGCCGAAACGGGTGATCGCTCTCGACT
GCTGCCTGAACATCAACAAGCGCGCCGACGCCAAGCACAAGTACCTGATCGCCCTCTACA
CCAAGGACGAGTACTTCGCCGTGGCCGCCGAGAACGAGCAGGAGCAGGAGGGCTGGTACC
GCGCGCTCACCGACCTGGTCAGCGAGGGCCGCGCGGCCGCCGGAGACGCGCCCCCCGCCG
CCGCGCCCGCCGCGTCCTGCAGCGCCTCCCTGCCCGGCGCCCTGGGCGGCTCTGCCGGCG
CCGCCGGGGCCGAGGACAGCTACGGGCTGGTGGCTCCCGCCACGGCCGCCTACCGTGAGG
TGTGGCAGGTGAACCTGAAGCCCAAGGGTCTGGGCCAGAGCAAGAACCTGACGGGGGTGT
ACCGTCTGTGCCTGTCTGCGCGCACCATCGGCTTCGTGAAGCTCAACTGCGAGCAGCCGT
CGGTGACGCTGCAGCTCATGAACATCCGCCGCTGCGGCCACTCGGACAGCTTCTTCTTCA
TCGAGGTGGGCCGCTCGGCCGTCACAGGCCCCGGCGAGCTGTGGATGCAGGCGGACGACT
CGGTGGTGGCGCAGAACATCCACGAGACCATCCTGGAGGCCATGAAGGCGCTCAAGGAGC
TCTTCGAGTTCCGGCCGCGCAGTAAGAGCCAATCGTCGGGGTCGTCGGCCACGCACCCCA
TCAGCGTCCCCGGCGCGCGCCGCCACCACCACCTGGTCAACCTGCCCCCCAGCCAGACGG
GCCTGGTGCGCCGCTCGCGCACCGACAGCCTGGCCGCCACCCCGCCGGCGGCCAAGTGCA
GCTCGTGCCGGGTGCGCACCGCCAGCGAGGGCGACGGCGGCGCGGCGGCGGGAGCGGCGG
CCGCGGGCGCCAGGCCGGTGTCGGTGGCTGGGAGCCCCCTGAGCCCCGGGCCGGTGCGCG
CGCCCCTGAGCCGCTCGCACACCCTGAGCGGCGGCTGCGGCGGCCGCGGGAGCAAGGTGG
CGCTGCTGCCGGCAGGGGGCGCGCTGCAACACAGCCGCTCCATGTCCATGCCCGTGGCGC
ACTCGCCGCCCGCCGCCACCAGCCCCGGCTCCCTGTCGTCCAGCAGCGGCCACGGCTCGG
GCTCCTACCCGCCGCCGCCCGGCCCGCACCCGCCTCTGCCGCATCCGCTGCACCACGGCC
CCGGCCAGCGGCCCTCCAGCGGCAGCGCCTCCGCCTCGGGCTCCCCCAGCGACCCCGGCT
TCATGTCCCTGGACGAGTACGGCTCCAGCCCAGGCGACCTGCGCGCCTTCTGCAGCCACC
GAAGCAACACGCCCGAGTCCATCGCGGAGACGCCCCCGGCCCGAGACGGCGGCGGCGGCG
GTGAGTTCTACGGGTACATGACCATGGACAGGCCCCTGAGCCACTGTGGCCGCTCCTACC
GCCGGGTCTCGGGGGACGCGGCCCAGGACCTGGACCGAGGGCTGCGCAAGAGGACCTACT
CCCTGACCACGCCAGCCCGGCAGCGGCCGGTGCCCCAGCCCTCCTCTGCCTCGCTGGATG
AATACACCCTGATGCGGGCCACCTTCTCGGGCAGCGCGGGCCGCCTCTGCCCGTCCTGCC
CCGCGTCCTCTCCCAAGGTGGCCTACCACCCCTACCCAGAGGACTACGGAGACATCGAGA
TCGGCTCCCACAGGAGCTCCAGCAGCAACCTGGGGGCAGACGACGGCTACATGCCCATGA
CGCCCGGCGCGGCCCTCGCGGGCAGTGGGAGCGGCAGCTGCAGGAGCGACGACTACATGC
CCATGAGCCCCGCCAGCGTGTCCGCCCCCAAGCAGATCTTGCAGCCCAGGGCCGCCGCCG
CCGCCGCCGCCGCCGTGCCTTCTGCGGGGCCTGCGGGGCCAGCACCCACCTCTGCGGCGG
GCAGGACATTCCCGGCGAGCGGGGGCGGCTACAAGGCCAGCTCGCCCGCCGAGAGCTCCC
CCGAGGACAGTGGGTACATGCGCATGTGGTGCGGTTCCAAGCTGTCCATGGAGCATGCAG
ATGGCAAGCTGCTGCCCAACGGGGACTACCTCAACGTGTCCCCCAGCGACGCGGTCACCA
CGGGCACCCCGCCCGACTTCTTCTCCGCAGCCCTGCACCCCGGCGGGGAGCCGCTCAGGG
GCGTTCCCGGCTGCTGCTACAGCTCCTTGCCCCGCTCCTACAAGGCCCCCTACACCTGTG
GCGGGGACAGCGACCAGTACGTGCTCATGAGCTCCCCCGTGGGGCGCATCCTGGAGGAGG
AGCGTCTGGAGCCTCAGGCCACGCCAGGGCCCAGCCAGGCGGCCAGCGCCTTCGGGGCCG
GCCCCACGCAGCCCCCTCACCCTGTAGTGCCTTCGCCCGTGCGGCCTAGCGGCGGCCGCC
CGGAGGGCTTCTTGGGCCAGCGCGGCCGGGCGGTGAGGCCCACGCGCCTGTCCCTGGAGG
GGCTGCCCAGCCTGCCCAGCATGCACGAGTACCCACTGCCACCGGAGCCCAAGAGCCCCG
GCGAGTACATCAACATCGACTTTGGCGAGCCCGGGGCCCGCCTGTCGCCGCCCGCGCCTC
CCCTGCTGGCGTCGGCGGCCTCGTCCTCCTCGCTCTTGTCCGCCAGCAGCCCGGCCTCGT
CGCTGGGCTCAGGCACCCCGGGCACCAGCAGCGACAGCCGGCAGCGGTCTCCGCTCTCCG
ACTACATGAACCTCGACTTCAGCTCCCCCAAGTCTCCTAAGCCGGGCGCCCCGAGCGGCC
ACCCCGTGGGCTCCTTGGACGGCCTCCTGTCCCCCGAGGCCTCCTCCCCGTATCCGCCGT
TGCCCCCGCGTCCGTCCGCGTCCCCGTCGTCGTCTCTGCAGCCGCCGCCACCGCCGCCGG
CCCCGGGGGAGCTGTACCGCCTGCCCCCCGCCTCGGCCGTTGCCACCGCCCAGGGCCCGG
GCGCCGCCTCATCGTTGTCCTCGGACACCGGGGACAATGGTGACTACACCGAGATGGCTT
TTGGTGTGGCCGCCACCCCGCCGCAACCTATCGCGGCCCCCCCGAAGCCAGAAGCTGCCC
GCGTGGCCAGCCCGACGTCGGGCGTGAAGAGGCTGAGCCTCATGGAGCAGGTGTCGGGAG
TCGAGGCCTTCCTGCAGGCCAGCCAGCCCCCGGACCCCCACCGCGGCGCCAAGGTCATCC
GCGCAGACCCGCAGGGGGGCCGCCGCCGCCACAGTTCCGAGACCTTCTCCTCCACCACGA
CGGTCACCCCCGTGTCCCCGTCCTTCGCCCACAACCCCAAGCGCCACAACTCGGCCTCCG
TGGAAAATGTCTCTCTCAGGAAAAGCAGCGAGGGCGGCGTGGGTGTCGGCCCTGGAGGGG
GCGACGAGCCGCCCACCTCCCCACGACAGTTGCAGCCGGCGCCCCCTTTGGCACCGCAGG
GCCGGCCGTGGACCCCGGGTCAGCCCGGGGGCTTGGTCGGTTGTCCTGGGAGCGGTGGAT
CGCCCATGCGCAGAGAGACCTCTGCCGGCTTCCAGAATGGTCTCAACTACATCGCCATCG
ACGTGAGGGAGGAGCCCGGGCTGCCACCCCAGCCGCAGCCGCCGCCGCCGCCGCTTCCTC
AGCCGGGAGACAAGAGCTCCTGGGGCCGGACCCGAAGCCTCGGGGGTCTCATCAGCGCTG
TGGGCGTCGGCAGCACCGGCGGCGGGTGCGGGGGGCCGGGTCCCGGTGCCCTGCCCCCTG
CCAACACCTACGCCAGCATTGACTTCTTGTCCCACCACTTGAAGGAGGCCACCATCGTGA
AAG
gtgaggaggccctttgccttggcgtctggcgggaaggaggggcggggcgctgagggagcc
tcttgggtttcactgctcccactttttggggaccttgacccagaagccgacagcctggca
ctggctccttgttttgtttttctgcgggctgccctgttctcttccttcagagaacttgcc

 1.03 Intr +   5939   6049  111  0  0   59   94    28 0.275   2.02
catttccgttttacacacaaactgtgggagcttttccatcagaggcattgtttttctcgg
aaggggtgaaacggtaaggctgcacacagcctaatgcagtggtgttcaacttgagcatat
gtgggagttacctggaggctttgctgaaacatggatctctggcctgtgttaaccccgcag
TTTCCGATGCTGTAGCTTTGGGGCGCGGCCCAGGCTGTGCATTTCTAGTGAGTCTCCGCA
TAATGCCGATGCTGCTGGCCGGGGGACCACCCTGTGAGGACCCTGCCCCAG
gtgagactcacctggggaggattgaaaaattacctgttgggcctcaccccagacccgttg
aagtgaaacatgagatggctaggaggcagggacggacatttttcagagttgtccaggtga
tttgaatgtgcagccaggatttacaatcagtgctttggagaaaacaagggaaagacaaaa

Predicted peptide sequence(s):


>IRS2_1|GENSCAN_predicted_peptide_1|1539_aa
FSHSVRDVLLTVRRGPRRARVAVGSSSSNTSSSSSPGGGADPERPGAPRLPGARRGGSSP
ASASPGAAREPEEAAAAGSRGGGRPPPAPGILRSPRARRARRRRAVLAPAGLPGPSPPPG
PEGRVIGRAAGRKGGREPPPPAPPPPLAPTPGRRARAARPEAPAMASPPRHGPPGPASGD
GPNLNNNNNNNNHSVRKCGYLRKQKHGHKRFFVLRGPGAGGDEATAGGGSAPQPPRLEYY
ESEKKWRSKAGAPKRVIALDCCLNINKRADAKHKYLIALYTKDEYFAVAAENEQEQEGWY
RALTDLVSEGRAAAGDAPPAAAPAASCSASLPGALGGSAGAAGAEDSYGLVAPATAAYRE
VWQVNLKPKGLGQSKNLTGVYRLCLSARTIGFVKLNCEQPSVTLQLMNIRRCGHSDSFFF
IEVGRSAVTGPGELWMQADDSVVAQNIHETILEAMKALKELFEFRPRSKSQSSGSSATHP
ISVPGARRHHHLVNLPPSQTGLVRRSRTDSLAATPPAAKCSSCRVRTASEGDGGAAAGAA
AAGARPVSVAGSPLSPGPVRAPLSRSHTLSGGCGGRGSKVALLPAGGALQHSRSMSMPVA
HSPPAATSPGSLSSSSGHGSGSYPPPPGPHPPLPHPLHHGPGQRPSSGSASASGSPSDPG
FMSLDEYGSSPGDLRAFCSHRSNTPESIAETPPARDGGGGGEFYGYMTMDRPLSHCGRSY
RRVSGDAAQDLDRGLRKRTYSLTTPARQRPVPQPSSASLDEYTLMRATFSGSAGRLCPSC
PASSPKVAYHPYPEDYGDIEIGSHRSSSSNLGADDGYMPMTPGAALAGSGSGSCRSDDYM
PMSPASVSAPKQILQPRAAAAAAAAVPSAGPAGPAPTSAAGRTFPASGGGYKASSPAESS
PEDSGYMRMWCGSKLSMEHADGKLLPNGDYLNVSPSDAVTTGTPPDFFSAALHPGGEPLR
GVPGCCYSSLPRSYKAPYTCGGDSDQYVLMSSPVGRILEEERLEPQATPGPSQAASAFGA
GPTQPPHPVVPSPVRPSGGRPEGFLGQRGRAVRPTRLSLEGLPSLPSMHEYPLPPEPKSP
GEYINIDFGEPGARLSPPAPPLLASAASSSSLLSASSPASSLGSGTPGTSSDSRQRSPLS
DYMNLDFSSPKSPKPGAPSGHPVGSLDGLLSPEASSPYPPLPPRPSASPSSSLQPPPPPP
APGELYRLPPASAVATAQGPGAASSLSSDTGDNGDYTEMAFGVAATPPQPIAAPPKPEAA
RVASPTSGVKRLSLMEQVSGVEAFLQASQPPDPHRGAKVIRADPQGGRRRHSSETFSSTT
TVTPVSPSFAHNPKRHNSASVENVSLRKSSEGGVGVGPGGGDEPPTSPRQLQPAPPLAPQ
GRPWTPGQPGGLVGCPGSGGSPMRRETSAGFQNGLNYIAIDVREEPGLPPQPQPPPPPLP
QPGDKSSWGRTRSLGGLISAVGVGSTGGGCGGPGPGALPPANTYASIDFLSHHLKEATIV
KVSDAVALGRGPGCAFLVSLRIMPMLLAGGPPCEDPAPX