GENSCAN 1.0	Date run: 15-Jan-104	Time: 05:51:44

Sequence IL17D_1 : 22154 bp : 52.39% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +   1009   1178  170  2  2   83  105    56 0.140   6.98
gactgctttccttaatagagaaatctctctgagccaaaatcggcctcccccaattccatc
ctgtcggccccacttttctgcttcggagacttccaagccagtccccactcctccttcagc
cagtcgggcccgcacccgcgcccggcagggccagccctctcctcctcctgcgtggcgcag
CACAGGCCCTGAGCGCGCGACCCCAGGCCCTGGGCGCCCCGCCGCATGCTCGCGGCTGGA
AGCCCCAGTTTGCGTGGCCCTTCGGGTTATTCCGCTCAAGAGCCGCCGCGTCGCCCCATC
TCGGCGCGAATCTGAAAGCGCTTTCGGGGGAGAAGATGTTGGGGGCACTG
gtgagtacactgcacaagtgacaaaatgttttcagctcctggaggcgaaaggtgcagagt
cgctctgtgtccgtgaggccgggcggcgacctcgctcagtcggcttctcggtccgagtcc
ccgggtacgaggaaagaccacagggggcttctcgcggaaaagcgggccgcggaccctgcg

 1.02 Intr +   1854   2149  296  2  2   61   99   369 0.239  31.65
gcaggcggggagggcgctctggggcccgcccgcgcggctcccatcctccgggccggcctc
tggctccgcggggcgaggggaggcgcccgccggctccgggcgccgcgggcgggacacggg
cgcggggcgcaggcgggctcctccggcgcgtgcggacgctgagcgtggcctgtccctcag
GTCTGGATGCTGGTAGCCGGCTTCCTGCTGGCGCTGCCGCCGAGCTGGGCCGCGGGCGCC
CCGAGGGCGGGCAGGCGCCCCGCGCGGCCGCGGGGCTGCGCGGACCGGCCGGAGGAGCTA
CTGGAGCAGCTGTACGGGCGCCTGGCGGCCGGCGTGCTCAGTGCCTTCCACCACACGCTG
CAGCTGGGGCCGCGTGAGCAGGCGCGCAACGCGAGCTGCCCGGCAGGGGGCAGGCCCGCC
GACCGCCGCTTCCGGCCGCCCACCAACCTGCGCAGCGTGTCGCCCTGGGCCTACAG
gtgagccgcgggcgcgtcctggcggggcccggcaggtggggagggcagggctgggcgggg
agagtgggtggggccgggccgaggccgggcaggcggggagggtggggcggggaaggggag
gtggttggggcggggcgacgcggagggggcgtggcacgcggggcgaggcggagcaggtag

 1.03 Intr +   7747   7831   85  1  1   24   81    95 0.002   2.72
tttctgccatgtgcacatattccttatttcaaagacatgttagtttttaagttgagagca
gaaagggaatttctccaaccacgagaaaaaagcagatactgaggaaatgaagcttcagca
caaacaacagcctgggacataccaagggcattggttgaagggcaccgtttgctcttaaag
GCTCTGGGGCTTCCTGAAGAGGCACTGCAGACATCTGGATGGATTTTCAGAGTTCCTGCG
ACTCCATGGCTGGTTTGTGCTCCTG
gtgaggagcccagacctggaaagatgaaggtattggccccaggtgacagacaggaaatag
tagagccaggagtcatcctggacctctctggttccgtctagcccaagtcccacccagtgt
gctgttagaaaacaacattcagcttccagaatacaaaaatattttttcacttactttgtg

 1.04 Intr +  14522  14666  145  1  1   76  -30    61 0.000  -6.53
atgtcacatgatcagtcctgccgttaggaaattgtgggaagtgctcatcaaatccatctc
cttcactttgcaaagaaccaggcaaggtggagttctctgcccaaggttactgggtggtga
ctaagttgggctacagttttaggtcccagactcttaatggctgcatcctccccttttaag
AGAGTCTGCTGGGTTGAACTCATTGACCTTCGGATCTGGCGAGCCACGCTACCGAGGCAG
GCTGTCTCCACGGACACATTTCGGTGCTTGTGGGTTCTAGCCAAGATTGGAGAAGGCATT
GCCCCCACTTTGTTCCTGGGATGGG
gtctttcaactgctgtgagataaacagtcatcctgagcccctgctgctctgaaatcattt
catgttttgcaaggtgggagggtgagccacatcaaggcgcgtgtgccaaccagcgcccca
gctatccttgggcatcagttagaggacacatcaggtggcccgatcctccctcggaatgtg

 1.05 Term +  19430  19812  383  0  2   42   54   660 0.000  53.37
acattagcccagactctggaagtagttttccggcctggctcagggctggctagatgtgcc
gtcatttcaaatgtaaggaagcgccgggcagatctgttgtcggcggggggcctcgcacgc
acgcgcccgcaggcggaggacaggacagtccccgaggccctccccggtgactctaaccag
GGATTTCAGCGCGCGGCGCGGGGCTGCCCCCAGGCGTGACCTCACCCGTGCTCTCTCCCT
GCAGAATCTCCTACGACCCGGCGAGGTACCCCAGGTACCTGCCTGAAGCCTACTGCCTGT
GCCGGGGCTGCCTGACCGGGCTGTTCGGCGAGGAGGACGTGCGCTTCCGCAGCGCCCCTG
TCTACATGCCCACCGTCGTCCTGCGCCGCACCCCCGCCTGCGCCGGCGGCCGTTCCGTCT
ACACCGAGGCCTACGTCACCATCCCCGTGGGCTGCACCTGCGTCCCCGAGCCGGAGAAGG
ACGCAGACAGCATCAACTCCAGCATCGACAAACAGGGCGCCAAGCTCCTGCTGGGCCCCA
ACGACGCGCCCGCTGGCCCCTGA
ggccggtcctgccccgggaggtctccccggcccgcatcccgaggcgcccaagctggagcc
gcctggagggctcggtcggcgacctctgaagagagtgcaccgagcaaaccaagtgccgga
gcaccagcgccgcctttccatggagactcgtaagcagcttcatctgacacgggcatccct

Predicted peptide sequence(s):


>IL17D_1|GENSCAN_predicted_peptide_1|359_aa
XQALSARPQALGAPPHARGWKPQFAWPFGLFRSRAAASPHLGANLKALSGEKMLGALVWM
LVAGFLLALPPSWAAGAPRAGRRPARPRGCADRPEELLEQLYGRLAAGVLSAFHHTLQLG
PREQARNASCPAGGRPADRRFRPPTNLRSVSPWAYRLWGFLKRHCRHLDGFSEFLRLHGW
FVLLRVCWVELIDLRIWRATLPRQAVSTDTFRCLWVLAKIGEGIAPTLFLGWGISARGAG
LPPGVTSPVLSPCRISYDPARYPRYLPEAYCLCRGCLTGLFGEEDVRFRSAPVYMPTVVL
RRTPACAGGRSVYTEAYVTIPVGCTCVPEPEKDADSINSSIDKQGAKLLLGPNDAPAGP